BLASTX nr result
ID: Paeonia25_contig00030562
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00030562 (311 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EIW56160.1| MFS polyamine transporter [Trametes versicolor FP... 67 2e-09 ref|XP_007365696.1| MFS general substrate transporter [Dichomitu... 59 5e-07 >gb|EIW56160.1| MFS polyamine transporter [Trametes versicolor FP-101664 SS1] Length = 538 Score = 67.4 bits (163), Expect = 2e-09 Identities = 32/49 (65%), Positives = 40/49 (81%) Frame = -3 Query: 309 ALLLAPSPYLFFKYGAWVRSKSQFSANVDLKLAIEMAEAEALQTWGEEK 163 ALLLAPSP+LF+KYGAW+R KS+FS +DL +A E+A AEA +T G EK Sbjct: 489 ALLLAPSPFLFYKYGAWIRQKSRFSPCLDLIIAKEIAAAEAAETKGSEK 537 >ref|XP_007365696.1| MFS general substrate transporter [Dichomitus squalens LYAD-421 SS1] gi|395329213|gb|EJF61601.1| MFS general substrate transporter [Dichomitus squalens LYAD-421 SS1] Length = 553 Score = 59.3 bits (142), Expect = 5e-07 Identities = 28/44 (63%), Positives = 35/44 (79%) Frame = -3 Query: 309 ALLLAPSPYLFFKYGAWVRSKSQFSANVDLKLAIEMAEAEALQT 178 ALLLAPSP+LF+KYG WVR+KS+FS +DL +A E+A EA T Sbjct: 503 ALLLAPSPFLFYKYGTWVRAKSKFSPCLDLAIAKEIAAEEAAAT 546