BLASTX nr result
ID: Paeonia25_contig00030280
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00030280 (249 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMD31873.1| hypothetical protein CERSUDRAFT_119153 [Ceriporio... 59 5e-07 ref|XP_007363508.1| Mob1/phocein [Dichomitus squalens LYAD-421 S... 57 2e-06 ref|XP_003032352.1| hypothetical protein SCHCODRAFT_109296 [Schi... 55 8e-06 >gb|EMD31873.1| hypothetical protein CERSUDRAFT_119153 [Ceriporiopsis subvermispora B] Length = 594 Score = 59.3 bits (142), Expect = 5e-07 Identities = 33/57 (57%), Positives = 40/57 (70%), Gaps = 7/57 (12%) Frame = +3 Query: 6 GQWLKM--DAGDARGESPGA-----RNESPRKMGRNRTDTMVFSEAVNVAEELARAE 155 G WL + G R SP RNESPRK+GR+RTDTMVFSEAV+VAEEL++A+ Sbjct: 277 GPWLAQPEEYGRERDRSPPGPAGHERNESPRKLGRSRTDTMVFSEAVSVAEELSKAD 333 >ref|XP_007363508.1| Mob1/phocein [Dichomitus squalens LYAD-421 SS1] gi|395331409|gb|EJF63790.1| Mob1/phocein [Dichomitus squalens LYAD-421 SS1] Length = 565 Score = 57.4 bits (137), Expect = 2e-06 Identities = 28/54 (51%), Positives = 39/54 (72%) Frame = +3 Query: 18 KMDAGDARGESPGARNESPRKMGRNRTDTMVFSEAVNVAEELARAEYIPDMDLD 179 ++D + RNESPRK GRNRTDTMV+SEA +VAEELA+ + + ++D+D Sbjct: 287 RLDDRSSPAPPSARRNESPRKFGRNRTDTMVYSEAFSVAEELAKGD-LSEVDID 339 >ref|XP_003032352.1| hypothetical protein SCHCODRAFT_109296 [Schizophyllum commune H4-8] gi|300106045|gb|EFI97449.1| hypothetical protein SCHCODRAFT_109296, partial [Schizophyllum commune H4-8] Length = 622 Score = 55.5 bits (132), Expect = 8e-06 Identities = 31/53 (58%), Positives = 39/53 (73%), Gaps = 4/53 (7%) Frame = +3 Query: 33 DARGESPGARN--ESPRKMGRNRTDTMVFSEAVNVAEELARAEY--IPDMDLD 179 +AR +SP ESPRK GRNRTDTMVFSEA +VAEEL+R E+ +P + L+ Sbjct: 251 NARAKSPPGLGGAESPRKFGRNRTDTMVFSEAQSVAEELSRREHADVPTIPLE 303