BLASTX nr result
ID: Paeonia25_contig00030218
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00030218 (675 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007366440.1| hypothetical protein DICSQDRAFT_127483 [Dich... 57 7e-06 >ref|XP_007366440.1| hypothetical protein DICSQDRAFT_127483 [Dichomitus squalens LYAD-421 SS1] gi|395328513|gb|EJF60905.1| hypothetical protein DICSQDRAFT_127483 [Dichomitus squalens LYAD-421 SS1] Length = 1389 Score = 56.6 bits (135), Expect = 7e-06 Identities = 28/41 (68%), Positives = 33/41 (80%), Gaps = 2/41 (4%) Frame = -2 Query: 218 PADSLMPSIFSRSRTTSTP--KVGLTAGALDEFGRINSRGS 102 P+D LMPS+FSR+RTTSTP K GALDEFGR++SRGS Sbjct: 203 PSDFLMPSLFSRARTTSTPTKKASSNLGALDEFGRVDSRGS 243