BLASTX nr result
ID: Paeonia25_contig00030051
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00030051 (746 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXB56306.1| BTB/POZ domain-containing protein [Morus notabilis] 58 4e-06 ref|XP_006473785.1| PREDICTED: BTB/POZ domain-containing protein... 57 7e-06 ref|XP_006473784.1| PREDICTED: BTB/POZ domain-containing protein... 57 7e-06 ref|XP_006435355.1| hypothetical protein CICLE_v10003249mg [Citr... 57 7e-06 >gb|EXB56306.1| BTB/POZ domain-containing protein [Morus notabilis] Length = 810 Score = 57.8 bits (138), Expect = 4e-06 Identities = 33/57 (57%), Positives = 40/57 (70%), Gaps = 3/57 (5%) Frame = -1 Query: 605 ILPKDAM---EGLIGNTV*PLHVRSQHRRSSFKELQYYICDGDNNGVLYFAGALAGK 444 +L KDA+ EG + +VR QHRRSS+KELQY ICDGD+NGVLYFAG G+ Sbjct: 598 LLVKDAISFIEGGLTGAEFEQNVRFQHRRSSYKELQY-ICDGDSNGVLYFAGTSYGE 653 >ref|XP_006473785.1| PREDICTED: BTB/POZ domain-containing protein At2g30600-like isoform X2 [Citrus sinensis] gi|568839635|ref|XP_006473786.1| PREDICTED: BTB/POZ domain-containing protein At2g30600-like isoform X3 [Citrus sinensis] Length = 806 Score = 57.0 bits (136), Expect = 7e-06 Identities = 28/35 (80%), Positives = 30/35 (85%) Frame = -1 Query: 548 VRSQHRRSSFKELQYYICDGDNNGVLYFAGALAGK 444 VR QHRRSSFKELQY ICDGD+NGVLYFAG G+ Sbjct: 616 VRFQHRRSSFKELQY-ICDGDSNGVLYFAGTSYGE 649 >ref|XP_006473784.1| PREDICTED: BTB/POZ domain-containing protein At2g30600-like isoform X1 [Citrus sinensis] Length = 817 Score = 57.0 bits (136), Expect = 7e-06 Identities = 28/35 (80%), Positives = 30/35 (85%) Frame = -1 Query: 548 VRSQHRRSSFKELQYYICDGDNNGVLYFAGALAGK 444 VR QHRRSSFKELQY ICDGD+NGVLYFAG G+ Sbjct: 627 VRFQHRRSSFKELQY-ICDGDSNGVLYFAGTSYGE 660 >ref|XP_006435355.1| hypothetical protein CICLE_v10003249mg [Citrus clementina] gi|557537477|gb|ESR48595.1| hypothetical protein CICLE_v10003249mg [Citrus clementina] Length = 818 Score = 57.0 bits (136), Expect = 7e-06 Identities = 28/35 (80%), Positives = 30/35 (85%) Frame = -1 Query: 548 VRSQHRRSSFKELQYYICDGDNNGVLYFAGALAGK 444 VR QHRRSSFKELQY ICDGD+NGVLYFAG G+ Sbjct: 628 VRFQHRRSSFKELQY-ICDGDSNGVLYFAGTSYGE 661