BLASTX nr result
ID: Paeonia25_contig00029195
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00029195 (452 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002535423.1| pentatricopeptide repeat-containing protein,... 45 2e-07 ref|XP_002523995.1| pentatricopeptide repeat-containing protein,... 45 5e-07 ref|XP_002264194.2| PREDICTED: pentatricopeptide repeat-containi... 43 2e-06 emb|CBI39966.3| unnamed protein product [Vitis vinifera] 43 2e-06 emb|CAN83351.1| hypothetical protein VITISV_028907 [Vitis vinifera] 43 4e-06 >ref|XP_002535423.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223523164|gb|EEF26960.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 563 Score = 45.1 bits (105), Expect(2) = 2e-07 Identities = 20/32 (62%), Positives = 24/32 (75%) Frame = -2 Query: 100 GVGLDLYIENVLVDLYARFNYFLKAHNMFEEI 5 G G DLYI N LVD+YARF +KA N+FEE+ Sbjct: 63 GFGFDLYIGNALVDMYARFGDLVKARNVFEEM 94 Score = 35.4 bits (80), Expect(2) = 2e-07 Identities = 19/47 (40%), Positives = 28/47 (59%), Gaps = 6/47 (12%) Frame = -3 Query: 213 NMYFK--PFN----SYLSPTVINVYPGLLDFEVGKIIYGYVLEVVLG 91 ++YFK FN +Y P+VIN L DFE+G ++ +VLE+ G Sbjct: 19 DLYFKMKDFNVKPDTYTFPSVINACAALGDFEIGNVVQNHVLEIGFG 65 >ref|XP_002523995.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223536722|gb|EEF38363.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 212 Score = 45.1 bits (105), Expect(2) = 5e-07 Identities = 20/32 (62%), Positives = 24/32 (75%) Frame = -2 Query: 100 GVGLDLYIENVLVDLYARFNYFLKAHNMFEEI 5 G G DLYI N LVD+YARF +KA N+FEE+ Sbjct: 40 GFGFDLYIGNALVDMYARFGDLVKARNVFEEM 71 Score = 34.3 bits (77), Expect(2) = 5e-07 Identities = 14/34 (41%), Positives = 22/34 (64%) Frame = -3 Query: 192 NSYLSPTVINVYPGLLDFEVGKIIYGYVLEVVLG 91 ++Y P+VIN L DFE+G ++ +VLE+ G Sbjct: 9 DTYTFPSVINACAALGDFEIGNVVQNHVLEIGFG 42 >ref|XP_002264194.2| PREDICTED: pentatricopeptide repeat-containing protein At3g03580-like [Vitis vinifera] Length = 889 Score = 43.1 bits (100), Expect(2) = 2e-06 Identities = 19/33 (57%), Positives = 23/33 (69%) Frame = -2 Query: 100 GVGLDLYIENVLVDLYARFNYFLKAHNMFEEIP 2 G G DLYI N L+D+Y RFN KA +FEE+P Sbjct: 145 GFGSDLYIGNALIDMYCRFNDLDKARKVFEEMP 177 Score = 34.3 bits (77), Expect(2) = 2e-06 Identities = 16/34 (47%), Positives = 23/34 (67%) Frame = -3 Query: 192 NSYLSPTVINVYPGLLDFEVGKIIYGYVLEVVLG 91 ++Y P+VIN GLLDFE+ K I+ VL++ G Sbjct: 114 DTYTFPSVINACAGLLDFEMAKSIHDRVLDMGFG 147 >emb|CBI39966.3| unnamed protein product [Vitis vinifera] Length = 726 Score = 43.1 bits (100), Expect(2) = 2e-06 Identities = 19/33 (57%), Positives = 23/33 (69%) Frame = -2 Query: 100 GVGLDLYIENVLVDLYARFNYFLKAHNMFEEIP 2 G G DLYI N L+D+Y RFN KA +FEE+P Sbjct: 145 GFGSDLYIGNALIDMYCRFNDLDKARKVFEEMP 177 Score = 34.3 bits (77), Expect(2) = 2e-06 Identities = 16/34 (47%), Positives = 23/34 (67%) Frame = -3 Query: 192 NSYLSPTVINVYPGLLDFEVGKIIYGYVLEVVLG 91 ++Y P+VIN GLLDFE+ K I+ VL++ G Sbjct: 114 DTYTFPSVINACAGLLDFEMAKSIHDRVLDMGFG 147 >emb|CAN83351.1| hypothetical protein VITISV_028907 [Vitis vinifera] Length = 948 Score = 43.1 bits (100), Expect(2) = 4e-06 Identities = 19/33 (57%), Positives = 23/33 (69%) Frame = -2 Query: 100 GVGLDLYIENVLVDLYARFNYFLKAHNMFEEIP 2 G G DLYI N L+D+Y RFN KA +FEE+P Sbjct: 204 GFGSDLYIGNALIDMYCRFNDLDKARKVFEEMP 236 Score = 33.1 bits (74), Expect(2) = 4e-06 Identities = 16/34 (47%), Positives = 22/34 (64%) Frame = -3 Query: 192 NSYLSPTVINVYPGLLDFEVGKIIYGYVLEVVLG 91 ++Y P+VIN GLLDFE+ K I+ VL + G Sbjct: 173 DTYTFPSVINACAGLLDFEMAKSIHDRVLXMGFG 206