BLASTX nr result
ID: Paeonia25_contig00028975
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00028975 (338 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006468720.1| PREDICTED: zinc finger MYM-type protein 1-li... 82 8e-14 ref|XP_006468718.1| PREDICTED: zinc finger MYM-type protein 1-li... 82 8e-14 dbj|BAA36225.1| transposase [Ipomoea purpurea] 82 8e-14 ref|XP_006491833.1| PREDICTED: uncharacterized protein LOC102614... 80 2e-13 ref|XP_004305235.1| PREDICTED: zinc finger MYM-type protein 1-li... 80 3e-13 ref|XP_004289455.1| PREDICTED: uncharacterized protein LOC101308... 80 3e-13 ref|XP_006431660.1| hypothetical protein CICLE_v10003389mg [Citr... 78 1e-12 ref|XP_006384009.1| hypothetical protein POPTR_0004s035802g, par... 76 6e-12 ref|XP_006381888.1| hypothetical protein POPTR_0006s19900g, part... 76 6e-12 ref|XP_006373846.1| hypothetical protein POPTR_0016s08340g [Popu... 76 6e-12 ref|XP_006389185.1| hypothetical protein POPTR_0039s00365g [Popu... 76 6e-12 ref|XP_006368918.1| hypothetical protein POPTR_0001s14710g [Popu... 75 9e-12 ref|XP_006386704.1| hypothetical protein POPTR_0002s19310g [Popu... 75 9e-12 ref|XP_006383590.1| hypothetical protein POPTR_0005s20440g [Popu... 74 2e-11 ref|XP_006382927.1| hypothetical protein POPTR_0005s08560g [Popu... 74 3e-11 ref|XP_007038587.1| Uncharacterized protein TCM_015088 [Theobrom... 74 3e-11 ref|XP_004298047.1| PREDICTED: zinc finger MYM-type protein 1-li... 74 3e-11 ref|XP_006369817.1| hypothetical protein POPTR_0001s32700g, part... 73 4e-11 ref|XP_002321318.2| hypothetical protein POPTR_0014s17470g [Popu... 73 4e-11 ref|XP_004310186.1| PREDICTED: uncharacterized protein LOC101293... 73 4e-11 >ref|XP_006468720.1| PREDICTED: zinc finger MYM-type protein 1-like isoform X3 [Citrus sinensis] gi|568828787|ref|XP_006468721.1| PREDICTED: zinc finger MYM-type protein 1-like isoform X4 [Citrus sinensis] Length = 353 Score = 82.0 bits (201), Expect = 8e-14 Identities = 43/70 (61%), Positives = 50/70 (71%) Frame = -2 Query: 214 SHLCKMLAKIRKSLVYPLIDRLIHLVLTLPVSIVTTERAFSIMNLIKISLCNKMGEKMFG 35 S LC+ L + +KS Y LIDRLI LVLTLPVS TTERAFS M+LIK SL NKM + Sbjct: 235 SELCRRLIETKKSQHYFLIDRLIRLVLTLPVSTATTERAFSAMSLIKTSLRNKMKNEFLS 294 Query: 34 ACMLTYIERE 5 CM+ Y+ERE Sbjct: 295 NCMVVYVERE 304 >ref|XP_006468718.1| PREDICTED: zinc finger MYM-type protein 1-like isoform X1 [Citrus sinensis] Length = 536 Score = 82.0 bits (201), Expect = 8e-14 Identities = 43/70 (61%), Positives = 50/70 (71%) Frame = -2 Query: 214 SHLCKMLAKIRKSLVYPLIDRLIHLVLTLPVSIVTTERAFSIMNLIKISLCNKMGEKMFG 35 S LC+ L + +KS Y LIDRLI LVLTLPVS TTERAFS M+LIK SL NKM + Sbjct: 418 SELCRRLIETKKSQHYFLIDRLIRLVLTLPVSTATTERAFSAMSLIKTSLRNKMKNEFLS 477 Query: 34 ACMLTYIERE 5 CM+ Y+ERE Sbjct: 478 NCMVVYVERE 487 >dbj|BAA36225.1| transposase [Ipomoea purpurea] Length = 808 Score = 82.0 bits (201), Expect = 8e-14 Identities = 38/70 (54%), Positives = 52/70 (74%) Frame = -2 Query: 214 SHLCKMLAKIRKSLVYPLIDRLIHLVLTLPVSIVTTERAFSIMNLIKISLCNKMGEKMFG 35 S LC+ L K RKS +YPL+ R++ LVLTLPVS TTER+FS MN++K +L NKM ++ Sbjct: 715 SDLCRWLVKTRKSNIYPLVFRVVTLVLTLPVSTATTERSFSAMNIVKTTLRNKMEDEFLS 774 Query: 34 ACMLTYIERE 5 C+L YIE++ Sbjct: 775 DCLLVYIEKQ 784 >ref|XP_006491833.1| PREDICTED: uncharacterized protein LOC102614219 [Citrus sinensis] Length = 518 Score = 80.5 bits (197), Expect = 2e-13 Identities = 42/70 (60%), Positives = 49/70 (70%) Frame = -2 Query: 214 SHLCKMLAKIRKSLVYPLIDRLIHLVLTLPVSIVTTERAFSIMNLIKISLCNKMGEKMFG 35 S LC+ L + RKS +Y L+DRLI LVLTLPVS TTERAFS M LIK + NKM + Sbjct: 423 SELCRRLIEARKSQIYFLLDRLIRLVLTLPVSTATTERAFSAMKLIKTTHRNKMENEFLS 482 Query: 34 ACMLTYIERE 5 CM+ YIERE Sbjct: 483 DCMVIYIERE 492 >ref|XP_004305235.1| PREDICTED: zinc finger MYM-type protein 1-like [Fragaria vesca subsp. vesca] Length = 512 Score = 80.1 bits (196), Expect = 3e-13 Identities = 39/71 (54%), Positives = 53/71 (74%) Frame = -2 Query: 214 SHLCKMLAKIRKSLVYPLIDRLIHLVLTLPVSIVTTERAFSIMNLIKISLCNKMGEKMFG 35 S LC+ L + RKS +P++ RLI LVLT+PVS TTERAFS MN+IK L +KMG++ G Sbjct: 419 SDLCRTLVQTRKSEFFPMLYRLICLVLTIPVSTATTERAFSAMNIIKNKLRSKMGDEYLG 478 Query: 34 ACMLTYIEREF 2 CM+ +IE+E+ Sbjct: 479 DCMVLHIEKEY 489 >ref|XP_004289455.1| PREDICTED: uncharacterized protein LOC101308327 [Fragaria vesca subsp. vesca] Length = 614 Score = 80.1 bits (196), Expect = 3e-13 Identities = 40/71 (56%), Positives = 52/71 (73%) Frame = -2 Query: 214 SHLCKMLAKIRKSLVYPLIDRLIHLVLTLPVSIVTTERAFSIMNLIKISLCNKMGEKMFG 35 S LC+ L + RKS P++ RLI LVLT+PVS TTERAFS MN+IK L NKMG++ G Sbjct: 520 SDLCRTLVQTRKSEFCPMLYRLICLVLTIPVSTATTERAFSAMNIIKNKLRNKMGDEYLG 579 Query: 34 ACMLTYIEREF 2 CM+ +IE+E+ Sbjct: 580 DCMVLHIEKEY 590 >ref|XP_006431660.1| hypothetical protein CICLE_v10003389mg [Citrus clementina] gi|557533782|gb|ESR44900.1| hypothetical protein CICLE_v10003389mg [Citrus clementina] Length = 688 Score = 77.8 bits (190), Expect = 1e-12 Identities = 35/70 (50%), Positives = 50/70 (71%) Frame = -2 Query: 214 SHLCKMLAKIRKSLVYPLIDRLIHLVLTLPVSIVTTERAFSIMNLIKISLCNKMGEKMFG 35 S LC+ L + R+SL+YPL+ ++I LVLTLP+S TTER+F MN++ LCNKM + Sbjct: 595 SDLCQWLVRTRRSLIYPLVYKIIVLVLTLPISTATTERSFLAMNIVNTRLCNKMDDDFLT 654 Query: 34 ACMLTYIERE 5 ++TYIER+ Sbjct: 655 DTLITYIERD 664 >ref|XP_006384009.1| hypothetical protein POPTR_0004s035802g, partial [Populus trichocarpa] gi|550340243|gb|ERP61806.1| hypothetical protein POPTR_0004s035802g, partial [Populus trichocarpa] Length = 546 Score = 75.9 bits (185), Expect = 6e-12 Identities = 42/70 (60%), Positives = 47/70 (67%) Frame = -2 Query: 214 SHLCKMLAKIRKSLVYPLIDRLIHLVLTLPVSIVTTERAFSIMNLIKISLCNKMGEKMFG 35 S LC+ LA+ KS Y LIDRLI LVLTLPVS TTERAFS M +K L NKM E+ Sbjct: 453 SELCRGLAETNKSQHYHLIDRLIRLVLTLPVSTATTERAFSAMKHVKTVLRNKMEEEFLA 512 Query: 34 ACMLTYIERE 5 M+ YIERE Sbjct: 513 DSMMIYIERE 522 >ref|XP_006381888.1| hypothetical protein POPTR_0006s19900g, partial [Populus trichocarpa] gi|550336681|gb|ERP59685.1| hypothetical protein POPTR_0006s19900g, partial [Populus trichocarpa] Length = 487 Score = 75.9 bits (185), Expect = 6e-12 Identities = 35/68 (51%), Positives = 48/68 (70%) Frame = -2 Query: 208 LCKMLAKIRKSLVYPLIDRLIHLVLTLPVSIVTTERAFSIMNLIKISLCNKMGEKMFGAC 29 LC+ L +I KS++YPL+DRLI L+LT+PVS TTER FS M ++K L N+M + Sbjct: 395 LCQGLVEIEKSIIYPLVDRLIWLILTIPVSTATTERTFSAMKIVKTRLRNRMEDDFLANY 454 Query: 28 MLTYIERE 5 ++ YIERE Sbjct: 455 LIVYIERE 462 >ref|XP_006373846.1| hypothetical protein POPTR_0016s08340g [Populus trichocarpa] gi|550321102|gb|ERP51643.1| hypothetical protein POPTR_0016s08340g [Populus trichocarpa] Length = 653 Score = 75.9 bits (185), Expect = 6e-12 Identities = 42/70 (60%), Positives = 47/70 (67%) Frame = -2 Query: 214 SHLCKMLAKIRKSLVYPLIDRLIHLVLTLPVSIVTTERAFSIMNLIKISLCNKMGEKMFG 35 S LC+ LA+ KS Y LIDRLI LVLTLPVS TTERAFS M +K L NKM E+ Sbjct: 560 SELCRGLAETNKSQHYHLIDRLIRLVLTLPVSTATTERAFSAMKHVKTVLRNKMEEEFLA 619 Query: 34 ACMLTYIERE 5 M+ YIERE Sbjct: 620 DSMMIYIERE 629 >ref|XP_006389185.1| hypothetical protein POPTR_0039s00365g [Populus trichocarpa] gi|550311881|gb|ERP48099.1| hypothetical protein POPTR_0039s00365g [Populus trichocarpa] Length = 530 Score = 75.9 bits (185), Expect = 6e-12 Identities = 42/70 (60%), Positives = 47/70 (67%) Frame = -2 Query: 214 SHLCKMLAKIRKSLVYPLIDRLIHLVLTLPVSIVTTERAFSIMNLIKISLCNKMGEKMFG 35 S LC+ LA+ KS Y LIDRLI LVLTLPVS TTERAFS M +K L NKM E+ Sbjct: 437 SELCRGLAETNKSQHYHLIDRLIRLVLTLPVSTATTERAFSAMKHVKTVLRNKMEEEFLA 496 Query: 34 ACMLTYIERE 5 M+ YIERE Sbjct: 497 DSMMIYIERE 506 >ref|XP_006368918.1| hypothetical protein POPTR_0001s14710g [Populus trichocarpa] gi|550347267|gb|ERP65487.1| hypothetical protein POPTR_0001s14710g [Populus trichocarpa] Length = 719 Score = 75.1 bits (183), Expect = 9e-12 Identities = 36/68 (52%), Positives = 47/68 (69%) Frame = -2 Query: 208 LCKMLAKIRKSLVYPLIDRLIHLVLTLPVSIVTTERAFSIMNLIKISLCNKMGEKMFGAC 29 LC+ L + KS +YPLIDRLI L+LTLPVS TTERAFS M ++K L N+M + Sbjct: 627 LCQGLVETEKSTIYPLIDRLIRLILTLPVSTTTTERAFSAMKIVKTRLRNRMEDDFLANY 686 Query: 28 MLTYIERE 5 ++ YIE+E Sbjct: 687 LIVYIEKE 694 >ref|XP_006386704.1| hypothetical protein POPTR_0002s19310g [Populus trichocarpa] gi|550345371|gb|ERP64501.1| hypothetical protein POPTR_0002s19310g [Populus trichocarpa] Length = 625 Score = 75.1 bits (183), Expect = 9e-12 Identities = 42/73 (57%), Positives = 48/73 (65%) Frame = -2 Query: 223 SFSSHLCKMLAKIRKSLVYPLIDRLIHLVLTLPVSIVTTERAFSIMNLIKISLCNKMGEK 44 S S LC+ LA+ KS Y LIDRLI LVLTLPVS TTERAFS M +K L NKM E+ Sbjct: 529 SIISELCRGLAETNKSQHYHLIDRLIRLVLTLPVSTATTERAFSAMKHVKTVLRNKMEEE 588 Query: 43 MFGACMLTYIERE 5 M+ YI+RE Sbjct: 589 FLADSMMIYIKRE 601 >ref|XP_006383590.1| hypothetical protein POPTR_0005s20440g [Populus trichocarpa] gi|550339386|gb|ERP61387.1| hypothetical protein POPTR_0005s20440g [Populus trichocarpa] Length = 634 Score = 74.3 bits (181), Expect = 2e-11 Identities = 41/70 (58%), Positives = 47/70 (67%) Frame = -2 Query: 214 SHLCKMLAKIRKSLVYPLIDRLIHLVLTLPVSIVTTERAFSIMNLIKISLCNKMGEKMFG 35 S LC+ LA+ KS Y LIDRLI LVLTLPVS TTERAFS M +K L NK+ E+ Sbjct: 541 SELCRGLAETNKSQHYHLIDRLIRLVLTLPVSTTTTERAFSAMKHVKTVLRNKIEEEFLA 600 Query: 34 ACMLTYIERE 5 M+ YIERE Sbjct: 601 DSMMIYIERE 610 >ref|XP_006382927.1| hypothetical protein POPTR_0005s08560g [Populus trichocarpa] gi|550338413|gb|ERP60724.1| hypothetical protein POPTR_0005s08560g [Populus trichocarpa] Length = 647 Score = 73.6 bits (179), Expect = 3e-11 Identities = 35/68 (51%), Positives = 47/68 (69%) Frame = -2 Query: 208 LCKMLAKIRKSLVYPLIDRLIHLVLTLPVSIVTTERAFSIMNLIKISLCNKMGEKMFGAC 29 LC+ L + KS +YPLIDRLI L+LTLPVS TTERAFS + ++K L N+M + Sbjct: 555 LCQGLVETEKSTIYPLIDRLIRLILTLPVSTATTERAFSAIKIVKTRLHNRMEDDFLANY 614 Query: 28 MLTYIERE 5 ++ YIE+E Sbjct: 615 LIVYIEKE 622 >ref|XP_007038587.1| Uncharacterized protein TCM_015088 [Theobroma cacao] gi|508775832|gb|EOY23088.1| Uncharacterized protein TCM_015088 [Theobroma cacao] Length = 216 Score = 73.6 bits (179), Expect = 3e-11 Identities = 38/75 (50%), Positives = 48/75 (64%) Frame = -2 Query: 229 DTSFSSHLCKMLAKIRKSLVYPLIDRLIHLVLTLPVSIVTTERAFSIMNLIKISLCNKMG 50 D S LC+ L + KS Y LIDRLIHL+LTL VS TTERAFS M ++K L NKM Sbjct: 117 DIKTLSELCQRLTETEKSKNYHLIDRLIHLILTLSVSTTTTERAFSAMKIVKTRLRNKMN 176 Query: 49 EKMFGACMLTYIERE 5 E+ ++ YIE++ Sbjct: 177 EEFLADNLVVYIEKD 191 >ref|XP_004298047.1| PREDICTED: zinc finger MYM-type protein 1-like [Fragaria vesca subsp. vesca] Length = 401 Score = 73.6 bits (179), Expect = 3e-11 Identities = 37/71 (52%), Positives = 50/71 (70%) Frame = -2 Query: 214 SHLCKMLAKIRKSLVYPLIDRLIHLVLTLPVSIVTTERAFSIMNLIKISLCNKMGEKMFG 35 + LC +L +IRKS YP+I RLI LVLT+PVS TT+RAF MN+IK L +KM + Sbjct: 307 AELCHILVQIRKSEFYPMIHRLICLVLTIPVSTATTKRAFLAMNIIKNRLRSKMEDDFLD 366 Query: 34 ACMLTYIEREF 2 CM+ +IE+E+ Sbjct: 367 DCMVLHIEKEY 377 >ref|XP_006369817.1| hypothetical protein POPTR_0001s32700g, partial [Populus trichocarpa] gi|550348725|gb|ERP66386.1| hypothetical protein POPTR_0001s32700g, partial [Populus trichocarpa] Length = 689 Score = 73.2 bits (178), Expect = 4e-11 Identities = 41/70 (58%), Positives = 47/70 (67%) Frame = -2 Query: 214 SHLCKMLAKIRKSLVYPLIDRLIHLVLTLPVSIVTTERAFSIMNLIKISLCNKMGEKMFG 35 S LC+ LA+ K Y LIDRLI LVLTLPVS TTERAFS M +KI L NK+ E+ Sbjct: 596 SELCRGLAETNKLQHYHLIDRLIRLVLTLPVSTATTERAFSAMKHVKIVLRNKIKEEFLT 655 Query: 34 ACMLTYIERE 5 M+ YIERE Sbjct: 656 DSMMIYIERE 665 >ref|XP_002321318.2| hypothetical protein POPTR_0014s17470g [Populus trichocarpa] gi|550324418|gb|EEE99633.2| hypothetical protein POPTR_0014s17470g [Populus trichocarpa] Length = 741 Score = 73.2 bits (178), Expect = 4e-11 Identities = 40/70 (57%), Positives = 46/70 (65%) Frame = -2 Query: 214 SHLCKMLAKIRKSLVYPLIDRLIHLVLTLPVSIVTTERAFSIMNLIKISLCNKMGEKMFG 35 S LC+ LA+ KS Y LIDRLI VLTLPVS VTTER FS M +K L NKM E+ Sbjct: 648 SELCRGLAETNKSQYYHLIDRLIRFVLTLPVSTVTTERIFSAMKHVKTVLRNKMKEEFLA 707 Query: 34 ACMLTYIERE 5 ++ YIERE Sbjct: 708 DSIMIYIERE 717 >ref|XP_004310186.1| PREDICTED: uncharacterized protein LOC101293653 [Fragaria vesca subsp. vesca] Length = 579 Score = 73.2 bits (178), Expect = 4e-11 Identities = 37/71 (52%), Positives = 50/71 (70%) Frame = -2 Query: 214 SHLCKMLAKIRKSLVYPLIDRLIHLVLTLPVSIVTTERAFSIMNLIKISLCNKMGEKMFG 35 S LC L + RKS +P++ RLI LVLT+ VS TTERAFS MN+IK L +KMG++ G Sbjct: 485 SDLCHTLVQTRKSEFFPMLYRLICLVLTIHVSTATTERAFSAMNIIKNKLRSKMGDEYLG 544 Query: 34 ACMLTYIEREF 2 CM+ +IE+ + Sbjct: 545 DCMVLHIEKAY 555