BLASTX nr result
ID: Paeonia25_contig00028974
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00028974 (299 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007300504.1| hypothetical protein STEHIDRAFT_51935 [Stere... 84 3e-14 ref|XP_007361210.1| dolichol phosphate-mannose biosynthesis regu... 83 4e-14 gb|EPT06165.1| hypothetical protein FOMPIDRAFT_1110563 [Fomitops... 82 6e-14 ref|XP_003036139.1| hypothetical protein SCHCODRAFT_51039 [Schiz... 80 4e-13 ref|XP_006458105.1| hypothetical protein AGABI2DRAFT_63676 [Agar... 79 5e-13 gb|ETW85888.1| hypothetical protein HETIRDRAFT_122363 [Heterobas... 79 7e-13 ref|XP_007264179.1| hypothetical protein FOMMEDRAFT_77985 [Fomit... 77 2e-12 ref|XP_001874864.1| predicted protein [Laccaria bicolor S238N-H8... 76 4e-12 gb|EPQ58101.1| hypothetical protein GLOTRDRAFT_36421 [Gloeophyll... 75 7e-12 ref|XP_007321256.1| hypothetical protein SERLADRAFT_396305 [Serp... 75 1e-11 gb|EIW59982.1| dolichol phosphate-mannose biosynthesis regulator... 74 2e-11 gb|ESK96997.1| dolichol phosphate-mannose biosynthesis regulator... 74 3e-11 gb|EJU05492.1| hypothetical protein DACRYDRAFT_46282, partial [D... 72 1e-10 ref|XP_003233143.1| dolichol phosphate-mannose biosynthesis regu... 70 3e-10 ref|XP_003171449.1| hypothetical protein MGYG_05995 [Arthroderma... 70 3e-10 ref|XP_003189350.1| dolichol phosphate-mannose biosynthesis regu... 70 4e-10 ref|XP_002372963.1| dolichol phosphate-mannose biosynthesis regu... 70 4e-10 gb|EUC61684.1| dolichol phosphate-mannose biosynthesis regulator... 69 5e-10 ref|XP_002149927.1| dolichol phosphate-mannose biosynthesis regu... 68 1e-09 ref|XP_750052.1| dolichol phosphate-mannose biosynthesis regulat... 68 2e-09 >ref|XP_007300504.1| hypothetical protein STEHIDRAFT_51935 [Stereum hirsutum FP-91666 SS1] gi|389748871|gb|EIM90048.1| hypothetical protein STEHIDRAFT_51935 [Stereum hirsutum FP-91666 SS1] Length = 77 Score = 83.6 bits (205), Expect = 3e-14 Identities = 35/54 (64%), Positives = 44/54 (81%) Frame = -1 Query: 260 FVYYTIWTVLLPFFDKDALIHDLFPPREWAVRIAASTLVLGITAMGLFIGLTIV 99 F+YYT W +LLPFFD + IHDLFPPREWA+R+ A LV+G+T +GLFIG T+V Sbjct: 9 FIYYTTWALLLPFFDASSPIHDLFPPREWAIRLPAFLLVVGLTGIGLFIGSTVV 62 >ref|XP_007361210.1| dolichol phosphate-mannose biosynthesis regulatory protein Dpm2 [Dichomitus squalens LYAD-421 SS1] gi|395333571|gb|EJF65948.1| dolichol phosphate-mannose biosynthesis regulatory protein Dpm2 [Dichomitus squalens LYAD-421 SS1] Length = 78 Score = 83.2 bits (204), Expect = 4e-14 Identities = 39/66 (59%), Positives = 52/66 (78%), Gaps = 2/66 (3%) Frame = -1 Query: 260 FVYYTIWTVLLPFFDKDALIHDLFPPREWAVRIAASTLVLGITAMGLFIGLTIV--GGHS 87 F+YYT WT+LLPFFD+D+ IHD FP REWA+RI + +VLGI+A+GLF+G+ IV G S Sbjct: 9 FLYYTFWTLLLPFFDEDSPIHDWFPAREWALRIVSFIVVLGISAIGLFLGVRIVVDGKTS 68 Query: 86 PSKRMR 69 ++MR Sbjct: 69 EQRQMR 74 >gb|EPT06165.1| hypothetical protein FOMPIDRAFT_1110563 [Fomitopsis pinicola FP-58527 SS1] Length = 86 Score = 82.4 bits (202), Expect = 6e-14 Identities = 36/65 (55%), Positives = 47/65 (72%) Frame = -1 Query: 293 GGXXXXXXXXLFVYYTIWTVLLPFFDKDALIHDLFPPREWAVRIAASTLVLGITAMGLFI 114 GG +F+YYT+WT+LLPFFD + +HD FP REWAVRI A LV+GI+A+ LF+ Sbjct: 17 GGAMLFAAASVFIYYTVWTILLPFFDATSPVHDYFPSREWAVRIPAFILVVGISAISLFL 76 Query: 113 GLTIV 99 GL +V Sbjct: 77 GLAVV 81 >ref|XP_003036139.1| hypothetical protein SCHCODRAFT_51039 [Schizophyllum commune H4-8] gi|300109835|gb|EFJ01237.1| hypothetical protein SCHCODRAFT_51039, partial [Schizophyllum commune H4-8] Length = 88 Score = 79.7 bits (195), Expect = 4e-13 Identities = 36/66 (54%), Positives = 47/66 (71%) Frame = -1 Query: 296 VGGXXXXXXXXLFVYYTIWTVLLPFFDKDALIHDLFPPREWAVRIAASTLVLGITAMGLF 117 +GG +FVYYTIW +LLPFFD ++ IH FP REWAVR+ A LV+G++A+G F Sbjct: 8 IGGAMLFTAVFVFVYYTIWAILLPFFDPESPIHSYFPAREWAVRLPAFILVVGLSAVGAF 67 Query: 116 IGLTIV 99 IG TI+ Sbjct: 68 IGNTIL 73 >ref|XP_006458105.1| hypothetical protein AGABI2DRAFT_63676 [Agaricus bisporus var. bisporus H97] gi|426200135|gb|EKV50059.1| hypothetical protein AGABI2DRAFT_63676 [Agaricus bisporus var. bisporus H97] Length = 77 Score = 79.3 bits (194), Expect = 5e-13 Identities = 34/53 (64%), Positives = 40/53 (75%) Frame = -1 Query: 260 FVYYTIWTVLLPFFDKDALIHDLFPPREWAVRIAASTLVLGITAMGLFIGLTI 102 F YYT W +LLPFFD + IH LFPPREWAVR+ A LVLG+T +G+F G TI Sbjct: 9 FAYYTTWAILLPFFDSSSYIHGLFPPREWAVRLPAFILVLGLTVIGIFAGRTI 61 >gb|ETW85888.1| hypothetical protein HETIRDRAFT_122363 [Heterobasidion irregulare TC 32-1] Length = 77 Score = 79.0 bits (193), Expect = 7e-13 Identities = 35/54 (64%), Positives = 43/54 (79%) Frame = -1 Query: 260 FVYYTIWTVLLPFFDKDALIHDLFPPREWAVRIAASTLVLGITAMGLFIGLTIV 99 F YYTIW +LLPFFD + IH FP REWAVR+ A TLV+G++A+GLF+G TIV Sbjct: 9 FTYYTIWAILLPFFDPASPIHGWFPSREWAVRLPAFTLVVGLSAIGLFVGSTIV 62 >ref|XP_007264179.1| hypothetical protein FOMMEDRAFT_77985 [Fomitiporia mediterranea MF3/22] gi|393220547|gb|EJD06033.1| hypothetical protein FOMMEDRAFT_77985 [Fomitiporia mediterranea MF3/22] Length = 77 Score = 77.4 bits (189), Expect = 2e-12 Identities = 33/54 (61%), Positives = 41/54 (75%) Frame = -1 Query: 260 FVYYTIWTVLLPFFDKDALIHDLFPPREWAVRIAASTLVLGITAMGLFIGLTIV 99 F YYT W +LLPF DK +HDLFPPREWAVRI A V+G++ +G FIG+T+V Sbjct: 9 FTYYTTWAMLLPFLDKSNPLHDLFPPREWAVRIPAFLFVVGLSGIGSFIGVTVV 62 >ref|XP_001874864.1| predicted protein [Laccaria bicolor S238N-H82] gi|164650064|gb|EDR14305.1| predicted protein [Laccaria bicolor S238N-H82] Length = 77 Score = 76.3 bits (186), Expect = 4e-12 Identities = 33/54 (61%), Positives = 41/54 (75%) Frame = -1 Query: 260 FVYYTIWTVLLPFFDKDALIHDLFPPREWAVRIAASTLVLGITAMGLFIGLTIV 99 F YYT W +LLPFF K + IHD FP REWA+R+ A LVLG++A+G F+G TIV Sbjct: 9 FTYYTAWALLLPFFPKTSQIHDWFPSREWAIRLPAVLLVLGLSAIGAFVGYTIV 62 >gb|EPQ58101.1| hypothetical protein GLOTRDRAFT_36421 [Gloeophyllum trabeum ATCC 11539] Length = 77 Score = 75.5 bits (184), Expect = 7e-12 Identities = 33/54 (61%), Positives = 40/54 (74%) Frame = -1 Query: 260 FVYYTIWTVLLPFFDKDALIHDLFPPREWAVRIAASTLVLGITAMGLFIGLTIV 99 F YYT W +LLPFFD IHD FP REWAVR+ A LV G++A+G FIG+T+V Sbjct: 9 FTYYTFWALLLPFFDASNPIHDFFPSREWAVRLPAFILVSGLSAVGSFIGITVV 62 >ref|XP_007321256.1| hypothetical protein SERLADRAFT_396305 [Serpula lacrymans var. lacrymans S7.9] gi|336367604|gb|EGN95948.1| hypothetical protein SERLA73DRAFT_59512 [Serpula lacrymans var. lacrymans S7.3] gi|336380317|gb|EGO21470.1| hypothetical protein SERLADRAFT_396305 [Serpula lacrymans var. lacrymans S7.9] Length = 77 Score = 75.1 bits (183), Expect = 1e-11 Identities = 29/54 (53%), Positives = 41/54 (75%) Frame = -1 Query: 260 FVYYTIWTVLLPFFDKDALIHDLFPPREWAVRIAASTLVLGITAMGLFIGLTIV 99 FVYYT W ++LPFFD + +HD FP REWA+R+ A LVLG++ +G F+G T++ Sbjct: 9 FVYYTSWAIILPFFDATSPVHDYFPAREWAIRLPAFILVLGLSGIGFFVGSTVI 62 >gb|EIW59982.1| dolichol phosphate-mannose biosynthesis regulatory protein Dpm2 [Trametes versicolor FP-101664 SS1] Length = 78 Score = 74.3 bits (181), Expect = 2e-11 Identities = 33/63 (52%), Positives = 45/63 (71%) Frame = -1 Query: 260 FVYYTIWTVLLPFFDKDALIHDLFPPREWAVRIAASTLVLGITAMGLFIGLTIVGGHSPS 81 F+YYTIWT+LLP D+ + +H FP REWA+RI A +VLGI+A+GLF+G I+ Sbjct: 9 FLYYTIWTLLLPILDESSPVHAWFPSREWALRIPAFIVVLGISAIGLFLGARIIHDSHEE 68 Query: 80 KRM 72 KR+ Sbjct: 69 KRL 71 >gb|ESK96997.1| dolichol phosphate-mannose biosynthesis regulatory protein [Moniliophthora roreri MCA 2997] Length = 77 Score = 73.6 bits (179), Expect = 3e-11 Identities = 31/54 (57%), Positives = 41/54 (75%) Frame = -1 Query: 260 FVYYTIWTVLLPFFDKDALIHDLFPPREWAVRIAASTLVLGITAMGLFIGLTIV 99 FVYYT W +LLPFF+ + IH+ FP REWAVR+ A LV+G++ +G FIG TI+ Sbjct: 9 FVYYTTWAILLPFFEPSSQIHEYFPAREWAVRLPAFILVVGLSGIGFFIGSTIM 62 >gb|EJU05492.1| hypothetical protein DACRYDRAFT_46282, partial [Dacryopinax sp. DJM-731 SS1] Length = 88 Score = 71.6 bits (174), Expect = 1e-10 Identities = 34/65 (52%), Positives = 41/65 (63%) Frame = -1 Query: 296 VGGXXXXXXXXLFVYYTIWTVLLPFFDKDALIHDLFPPREWAVRIAASTLVLGITAMGLF 117 VGG +FVYYT W + LPF +HD FPPREWAV A LVLG+TA+GLF Sbjct: 8 VGGFFLFVASFVFVYYTTWAIFLPFLPPSHPLHDHFPPREWAVWGPALLLVLGVTAIGLF 67 Query: 116 IGLTI 102 IG+ + Sbjct: 68 IGMVM 72 >ref|XP_003233143.1| dolichol phosphate-mannose biosynthesis regulatory protein Dpm2 [Trichophyton rubrum CBS 118892] gi|326464449|gb|EGD89902.1| dolichol phosphate-mannose biosynthesis regulatory protein Dpm2 [Trichophyton rubrum CBS 118892] gi|326481218|gb|EGE05228.1| dolichol phosphate-mannose biosynthesis regulatory protein Dpm2 [Trichophyton equinum CBS 127.97] gi|607880449|gb|EZF25299.1| hypothetical protein H100_02376 [Trichophyton rubrum MR850] gi|607895110|gb|EZF33866.1| hypothetical protein H101_02571 [Trichophyton interdigitale H6] gi|607907164|gb|EZF44330.1| hypothetical protein H102_02373 [Trichophyton rubrum CBS 100081] gi|607919274|gb|EZF54998.1| hypothetical protein H103_02383 [Trichophyton rubrum CBS 288.86] gi|607931307|gb|EZF65599.1| hypothetical protein H104_02360 [Trichophyton rubrum CBS 289.86] gi|607943252|gb|EZF76242.1| hypothetical protein H105_02392 [Trichophyton soudanense CBS 452.61] gi|607955323|gb|EZF86891.1| hypothetical protein H110_02379 [Trichophyton rubrum MR1448] gi|607967515|gb|EZF97664.1| hypothetical protein H113_02389 [Trichophyton rubrum MR1459] gi|607979568|gb|EZG08577.1| hypothetical protein H106_02246 [Trichophyton rubrum CBS 735.88] gi|607991532|gb|EZG19219.1| hypothetical protein H107_02455 [Trichophyton rubrum CBS 202.88] Length = 90 Score = 70.1 bits (170), Expect = 3e-10 Identities = 28/54 (51%), Positives = 39/54 (72%) Frame = -1 Query: 260 FVYYTIWTVLLPFFDKDALIHDLFPPREWAVRIAASTLVLGITAMGLFIGLTIV 99 F+YYT WT+L+PF D+ +HDLFPPR WA+RI +LG T +G F+GL ++ Sbjct: 18 FLYYTAWTLLMPFVDQGHPLHDLFPPRVWAIRIPVILTILGSTVVGTFLGLVMI 71 >ref|XP_003171449.1| hypothetical protein MGYG_05995 [Arthroderma gypseum CBS 118893] gi|311343792|gb|EFR02995.1| hypothetical protein MGYG_05995 [Arthroderma gypseum CBS 118893] Length = 102 Score = 70.1 bits (170), Expect = 3e-10 Identities = 28/54 (51%), Positives = 39/54 (72%) Frame = -1 Query: 260 FVYYTIWTVLLPFFDKDALIHDLFPPREWAVRIAASTLVLGITAMGLFIGLTIV 99 F+YYT WT+L+PF D+ +HDLFPPR WA+RI +LG T +G F+GL ++ Sbjct: 30 FLYYTAWTLLMPFVDQGHPLHDLFPPRVWAIRIPVILTILGSTVVGTFLGLVMI 83 >ref|XP_003189350.1| dolichol phosphate-mannose biosynthesis regulatory protein [Aspergillus oryzae RIB40] Length = 103 Score = 69.7 bits (169), Expect = 4e-10 Identities = 30/69 (43%), Positives = 42/69 (60%) Frame = -1 Query: 296 VGGXXXXXXXXLFVYYTIWTVLLPFFDKDALIHDLFPPREWAVRIAASTLVLGITAMGLF 117 VG +F+YYT WT+L+PF D D +HDLFPPR WA+RI +LG +G F Sbjct: 19 VGSAMLLAATAIFLYYTAWTLLMPFVDLDHPLHDLFPPRVWAIRIPVILTLLGSAVVGTF 78 Query: 116 IGLTIVGGH 90 IG+ ++ + Sbjct: 79 IGIVMINSN 87 >ref|XP_002372963.1| dolichol phosphate-mannose biosynthesis regulatory protein Dpm2 [Aspergillus flavus NRRL3357] gi|220701013|gb|EED57351.1| dolichol phosphate-mannose biosynthesis regulatory protein Dpm2 [Aspergillus flavus NRRL3357] Length = 90 Score = 69.7 bits (169), Expect = 4e-10 Identities = 30/69 (43%), Positives = 42/69 (60%) Frame = -1 Query: 296 VGGXXXXXXXXLFVYYTIWTVLLPFFDKDALIHDLFPPREWAVRIAASTLVLGITAMGLF 117 VG +F+YYT WT+L+PF D D +HDLFPPR WA+RI +LG +G F Sbjct: 6 VGSAMLLAATAIFLYYTAWTLLMPFVDLDHPLHDLFPPRVWAIRIPVILTLLGSAVVGTF 65 Query: 116 IGLTIVGGH 90 IG+ ++ + Sbjct: 66 IGIVMINSN 74 >gb|EUC61684.1| dolichol phosphate-mannose biosynthesis regulatory protein [Rhizoctonia solani AG-3 Rhs1AP] Length = 77 Score = 69.3 bits (168), Expect = 5e-10 Identities = 29/54 (53%), Positives = 38/54 (70%) Frame = -1 Query: 260 FVYYTIWTVLLPFFDKDALIHDLFPPREWAVRIAASTLVLGITAMGLFIGLTIV 99 FVYYT W +LLP F D + LFPPREWA+R+ A L +G+TA+G FI + +V Sbjct: 9 FVYYTTWAILLPLFPADHALQSLFPPREWAIRLPAFILCVGLTAIGSFIAMVMV 62 >ref|XP_002149927.1| dolichol phosphate-mannose biosynthesis regulatory protein Dpm2, putative [Talaromyces marneffei ATCC 18224] gi|210067226|gb|EEA21318.1| dolichol phosphate-mannose biosynthesis regulatory protein Dpm2, putative [Talaromyces marneffei ATCC 18224] Length = 90 Score = 68.2 bits (165), Expect = 1e-09 Identities = 29/66 (43%), Positives = 42/66 (63%) Frame = -1 Query: 296 VGGXXXXXXXXLFVYYTIWTVLLPFFDKDALIHDLFPPREWAVRIAASTLVLGITAMGLF 117 VG +F+YYT WT+L+PF D+ +HDLFPPR WA+RI +LG T +G F Sbjct: 6 VGSAMLLVATAIFLYYTAWTLLMPFVDQGHPLHDLFPPRVWAIRIPVILTLLGSTVVGSF 65 Query: 116 IGLTIV 99 +G+ ++ Sbjct: 66 LGIMMI 71 >ref|XP_750052.1| dolichol phosphate-mannose biosynthesis regulatory protein Dpm2 [Aspergillus fumigatus Af293] gi|66847684|gb|EAL88014.1| dolichol phosphate-mannose biosynthesis regulatory protein Dpm2, putative [Aspergillus fumigatus Af293] gi|159130531|gb|EDP55644.1| dolichol phosphate-mannose biosynthesis regulatory protein Dpm2, putative [Aspergillus fumigatus A1163] Length = 79 Score = 67.8 bits (164), Expect = 2e-09 Identities = 28/57 (49%), Positives = 38/57 (66%) Frame = -1 Query: 260 FVYYTIWTVLLPFFDKDALIHDLFPPREWAVRIAASTLVLGITAMGLFIGLTIVGGH 90 F+YYT WT+L+PF D +HDLFPPR WA+RI +LG +G FIGL ++ + Sbjct: 9 FLYYTAWTLLMPFVDTGHPLHDLFPPRVWAIRIPVILTLLGSAVVGTFIGLVMINSN 65