BLASTX nr result
ID: Paeonia25_contig00028586
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00028586 (360 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS94985.1| hypothetical protein FOMPIDRAFT_1025982 [Fomitops... 69 9e-10 gb|EIW55729.1| Mo25-like protein [Trametes versicolor FP-101664 ... 67 2e-09 ref|XP_002475589.1| predicted protein [Postia placenta Mad-698-R... 67 2e-09 ref|XP_003026076.1| hypothetical protein SCHCODRAFT_62544 [Schiz... 67 3e-09 ref|XP_001883162.1| predicted protein [Laccaria bicolor S238N-H8... 67 3e-09 gb|EPQ51339.1| Mo25-like protein [Gloeophyllum trabeum ATCC 11539] 67 3e-09 gb|EMD36445.1| hypothetical protein CERSUDRAFT_51952 [Ceriporiop... 67 3e-09 gb|ESK84971.1| mo25 protein [Moniliophthora roreri MCA 2997] 66 6e-09 emb|CCL99916.1| predicted protein [Fibroporia radiculosa] 65 8e-09 ref|XP_007397931.1| hypothetical protein PHACADRAFT_99790 [Phane... 64 3e-08 ref|XP_001834805.2| mo25 protein [Coprinopsis cinerea okayama7#1... 62 6e-08 ref|XP_006457456.1| hypothetical protein AGABI2DRAFT_196148 [Aga... 62 8e-08 gb|EIW75607.1| mo25 protein [Coniophora puteana RWD-64-598 SS2] 62 1e-07 ref|XP_007323365.1| hypothetical protein SERLADRAFT_478432 [Serp... 61 1e-07 gb|EGN94446.1| hypothetical protein SERLA73DRAFT_62391 [Serpula ... 61 1e-07 ref|XP_007363389.1| mo25 protein [Dichomitus squalens LYAD-421 S... 59 7e-07 ref|XP_007261770.1| mo25 protein [Fomitiporia mediterranea MF3/2... 58 2e-06 ref|XP_007388034.1| mo25 protein [Punctularia strigosozonata HHB... 57 3e-06 ref|XP_007346358.1| mo25 protein [Auricularia delicata TFB-10046... 55 8e-06 >gb|EPS94985.1| hypothetical protein FOMPIDRAFT_1025982 [Fomitopsis pinicola FP-58527 SS1] Length = 329 Score = 68.6 bits (166), Expect = 9e-10 Identities = 30/36 (83%), Positives = 34/36 (94%) Frame = +3 Query: 252 MNFFKSRPRTPPDLVRGLRDALPRLEAGSPGSESRK 359 MNFFKS+PRTPPDLVRG++DALPRLEAG PGSE R+ Sbjct: 1 MNFFKSKPRTPPDLVRGIKDALPRLEAGQPGSEVRR 36 >gb|EIW55729.1| Mo25-like protein [Trametes versicolor FP-101664 SS1] Length = 328 Score = 67.4 bits (163), Expect = 2e-09 Identities = 30/36 (83%), Positives = 33/36 (91%) Frame = +3 Query: 252 MNFFKSRPRTPPDLVRGLRDALPRLEAGSPGSESRK 359 MNFFK++PRTPPDLVRGLRDALPRLEAG PG E R+ Sbjct: 1 MNFFKTKPRTPPDLVRGLRDALPRLEAGPPGGEVRR 36 >ref|XP_002475589.1| predicted protein [Postia placenta Mad-698-R] gi|220725206|gb|EED79203.1| predicted protein [Postia placenta Mad-698-R] Length = 137 Score = 67.4 bits (163), Expect = 2e-09 Identities = 29/36 (80%), Positives = 34/36 (94%) Frame = +3 Query: 252 MNFFKSRPRTPPDLVRGLRDALPRLEAGSPGSESRK 359 MNFFKS+PRTPPDLVRGLRDALP+L+ G PG+ESR+ Sbjct: 1 MNFFKSKPRTPPDLVRGLRDALPKLDVGPPGTESRR 36 >ref|XP_003026076.1| hypothetical protein SCHCODRAFT_62544 [Schizophyllum commune H4-8] gi|300099756|gb|EFI91173.1| hypothetical protein SCHCODRAFT_62544 [Schizophyllum commune H4-8] Length = 322 Score = 67.0 bits (162), Expect = 3e-09 Identities = 29/36 (80%), Positives = 34/36 (94%) Frame = +3 Query: 252 MNFFKSRPRTPPDLVRGLRDALPRLEAGSPGSESRK 359 MNFFK++PRTPPDLVRGLRDA+PRLEA +PG ESR+ Sbjct: 1 MNFFKTKPRTPPDLVRGLRDAVPRLEASAPGGESRR 36 >ref|XP_001883162.1| predicted protein [Laccaria bicolor S238N-H82] gi|164642043|gb|EDR06301.1| predicted protein [Laccaria bicolor S238N-H82] Length = 322 Score = 67.0 bits (162), Expect = 3e-09 Identities = 28/36 (77%), Positives = 34/36 (94%) Frame = +3 Query: 252 MNFFKSRPRTPPDLVRGLRDALPRLEAGSPGSESRK 359 MNFFK++PRTPPDLVRGLRDA+PRLE G+PG E+R+ Sbjct: 1 MNFFKTKPRTPPDLVRGLRDAIPRLEGGAPGGETRR 36 >gb|EPQ51339.1| Mo25-like protein [Gloeophyllum trabeum ATCC 11539] Length = 322 Score = 66.6 bits (161), Expect = 3e-09 Identities = 28/36 (77%), Positives = 34/36 (94%) Frame = +3 Query: 252 MNFFKSRPRTPPDLVRGLRDALPRLEAGSPGSESRK 359 MNFFK++PRTPPDLVRGLRDA+P+LEAG PG E+R+ Sbjct: 1 MNFFKTKPRTPPDLVRGLRDAIPKLEAGPPGGETRR 36 >gb|EMD36445.1| hypothetical protein CERSUDRAFT_51952 [Ceriporiopsis subvermispora B] Length = 322 Score = 66.6 bits (161), Expect = 3e-09 Identities = 28/36 (77%), Positives = 35/36 (97%) Frame = +3 Query: 252 MNFFKSRPRTPPDLVRGLRDALPRLEAGSPGSESRK 359 MNFFK++PRTPPDLV+GLRDALP+LEAG PG+E+R+ Sbjct: 1 MNFFKTKPRTPPDLVKGLRDALPKLEAGPPGTETRR 36 >gb|ESK84971.1| mo25 protein [Moniliophthora roreri MCA 2997] Length = 322 Score = 65.9 bits (159), Expect = 6e-09 Identities = 28/36 (77%), Positives = 35/36 (97%) Frame = +3 Query: 252 MNFFKSRPRTPPDLVRGLRDALPRLEAGSPGSESRK 359 MNFFK++ RTPPDLVRGLRDA+PRLE+G+PGSE+R+ Sbjct: 1 MNFFKTKQRTPPDLVRGLRDAIPRLESGAPGSETRR 36 >emb|CCL99916.1| predicted protein [Fibroporia radiculosa] Length = 329 Score = 65.5 bits (158), Expect = 8e-09 Identities = 29/36 (80%), Positives = 33/36 (91%) Frame = +3 Query: 252 MNFFKSRPRTPPDLVRGLRDALPRLEAGSPGSESRK 359 MNFFKS+PRTPPDLVRGLRD L +LEAG PGSE+R+ Sbjct: 1 MNFFKSKPRTPPDLVRGLRDVLSKLEAGPPGSETRR 36 >ref|XP_007397931.1| hypothetical protein PHACADRAFT_99790 [Phanerochaete carnosa HHB-10118-sp] gi|409043756|gb|EKM53238.1| hypothetical protein PHACADRAFT_99790 [Phanerochaete carnosa HHB-10118-sp] Length = 330 Score = 63.5 bits (153), Expect = 3e-08 Identities = 28/36 (77%), Positives = 32/36 (88%) Frame = +3 Query: 252 MNFFKSRPRTPPDLVRGLRDALPRLEAGSPGSESRK 359 MNFFK++PRTPPDLVRGLRD LPRLE+ PGSE R+ Sbjct: 1 MNFFKTKPRTPPDLVRGLRDTLPRLESTVPGSEQRR 36 >ref|XP_001834805.2| mo25 protein [Coprinopsis cinerea okayama7#130] gi|298403476|gb|EAU86979.2| mo25 protein [Coprinopsis cinerea okayama7#130] Length = 329 Score = 62.4 bits (150), Expect = 6e-08 Identities = 26/36 (72%), Positives = 32/36 (88%) Frame = +3 Query: 252 MNFFKSRPRTPPDLVRGLRDALPRLEAGSPGSESRK 359 MNFFK++PRTPPDLVRGLRD +PRLE +PG E+R+ Sbjct: 1 MNFFKTKPRTPPDLVRGLRDVIPRLENSAPGGETRR 36 >ref|XP_006457456.1| hypothetical protein AGABI2DRAFT_196148 [Agaricus bisporus var. bisporus H97] gi|597989325|ref|XP_007331807.1| hypothetical protein AGABI1DRAFT_115118 [Agaricus bisporus var. burnettii JB137-S8] gi|409077171|gb|EKM77538.1| hypothetical protein AGABI1DRAFT_115118 [Agaricus bisporus var. burnettii JB137-S8] gi|426191906|gb|EKV41845.1| hypothetical protein AGABI2DRAFT_196148 [Agaricus bisporus var. bisporus H97] Length = 330 Score = 62.0 bits (149), Expect = 8e-08 Identities = 26/36 (72%), Positives = 33/36 (91%) Frame = +3 Query: 252 MNFFKSRPRTPPDLVRGLRDALPRLEAGSPGSESRK 359 MNFFK++PRTPPDLVRGLRD++ RLE+G PG +SR+ Sbjct: 1 MNFFKTKPRTPPDLVRGLRDSIGRLESGPPGGDSRR 36 >gb|EIW75607.1| mo25 protein [Coniophora puteana RWD-64-598 SS2] Length = 330 Score = 61.6 bits (148), Expect = 1e-07 Identities = 26/36 (72%), Positives = 34/36 (94%) Frame = +3 Query: 252 MNFFKSRPRTPPDLVRGLRDALPRLEAGSPGSESRK 359 MNFFK++ RTP DLVRGLRDA+P+LE+G+PGSE+R+ Sbjct: 1 MNFFKTKQRTPSDLVRGLRDAIPKLESGAPGSETRR 36 >ref|XP_007323365.1| hypothetical protein SERLADRAFT_478432 [Serpula lacrymans var. lacrymans S7.9] gi|336378773|gb|EGO19930.1| hypothetical protein SERLADRAFT_478432 [Serpula lacrymans var. lacrymans S7.9] Length = 329 Score = 61.2 bits (147), Expect = 1e-07 Identities = 25/36 (69%), Positives = 33/36 (91%) Frame = +3 Query: 252 MNFFKSRPRTPPDLVRGLRDALPRLEAGSPGSESRK 359 MNFFK++ RTPPDLVRGLRD +P+LE+G PG+E+R+ Sbjct: 1 MNFFKTKQRTPPDLVRGLRDTIPKLESGPPGTETRR 36 >gb|EGN94446.1| hypothetical protein SERLA73DRAFT_62391 [Serpula lacrymans var. lacrymans S7.3] Length = 322 Score = 61.2 bits (147), Expect = 1e-07 Identities = 25/36 (69%), Positives = 33/36 (91%) Frame = +3 Query: 252 MNFFKSRPRTPPDLVRGLRDALPRLEAGSPGSESRK 359 MNFFK++ RTPPDLVRGLRD +P+LE+G PG+E+R+ Sbjct: 1 MNFFKTKQRTPPDLVRGLRDTIPKLESGPPGTETRR 36 >ref|XP_007363389.1| mo25 protein [Dichomitus squalens LYAD-421 SS1] gi|395331290|gb|EJF63671.1| mo25 protein [Dichomitus squalens LYAD-421 SS1] Length = 321 Score = 58.9 bits (141), Expect = 7e-07 Identities = 27/36 (75%), Positives = 30/36 (83%) Frame = +3 Query: 252 MNFFKSRPRTPPDLVRGLRDALPRLEAGSPGSESRK 359 MNFFK++PRTPPDLVRGLRDAL +LEA PG RK Sbjct: 1 MNFFKTKPRTPPDLVRGLRDALSKLEAEPPGDVRRK 36 >ref|XP_007261770.1| mo25 protein [Fomitiporia mediterranea MF3/22] gi|393222334|gb|EJD07818.1| mo25 protein [Fomitiporia mediterranea MF3/22] Length = 329 Score = 57.8 bits (138), Expect = 2e-06 Identities = 25/36 (69%), Positives = 32/36 (88%) Frame = +3 Query: 252 MNFFKSRPRTPPDLVRGLRDALPRLEAGSPGSESRK 359 MNFFK++ RTP D+VR LRDA+PRLE+ +PGSESR+ Sbjct: 1 MNFFKTKQRTPTDIVRALRDAIPRLESTAPGSESRR 36 >ref|XP_007388034.1| mo25 protein [Punctularia strigosozonata HHB-11173 SS5] gi|390595235|gb|EIN04641.1| mo25 protein [Punctularia strigosozonata HHB-11173 SS5] Length = 329 Score = 57.0 bits (136), Expect = 3e-06 Identities = 25/36 (69%), Positives = 32/36 (88%) Frame = +3 Query: 252 MNFFKSRPRTPPDLVRGLRDALPRLEAGSPGSESRK 359 MNFFK++ RTP DLVR LRDA+P+LE+G PGSE+R+ Sbjct: 1 MNFFKTKQRTPIDLVRQLRDAIPKLESGPPGSETRR 36 >ref|XP_007346358.1| mo25 protein [Auricularia delicata TFB-10046 SS5] gi|393237984|gb|EJD45523.1| mo25 protein [Auricularia delicata TFB-10046 SS5] Length = 329 Score = 55.5 bits (132), Expect = 8e-06 Identities = 22/36 (61%), Positives = 32/36 (88%) Frame = +3 Query: 252 MNFFKSRPRTPPDLVRGLRDALPRLEAGSPGSESRK 359 MNFFK++PR+P DLVRGLRDA+ +L++G PG ++R+ Sbjct: 1 MNFFKTKPRSPQDLVRGLRDAITKLDSGPPGGDTRR 36