BLASTX nr result
ID: Paeonia25_contig00028582
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00028582 (212 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007391069.1| hypothetical protein PHACADRAFT_82901 [Phane... 55 8e-06 >ref|XP_007391069.1| hypothetical protein PHACADRAFT_82901 [Phanerochaete carnosa HHB-10118-sp] gi|409052189|gb|EKM61665.1| hypothetical protein PHACADRAFT_82901 [Phanerochaete carnosa HHB-10118-sp] Length = 452 Score = 55.5 bits (132), Expect = 8e-06 Identities = 24/39 (61%), Positives = 32/39 (82%) Frame = -2 Query: 118 STLDVGPPVNRGMTDRLDKDAFKRSVPVLAAKVEQSKTG 2 +TLD PP+NRGM +RLDKDAF++++ VLAAKV +TG Sbjct: 5 NTLDALPPINRGMVERLDKDAFRKTIEVLAAKVAPQRTG 43