BLASTX nr result
ID: Paeonia25_contig00028292
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00028292 (321 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN70109.1| hypothetical protein VITISV_001696 [Vitis vinifera] 41 3e-06 >emb|CAN70109.1| hypothetical protein VITISV_001696 [Vitis vinifera] Length = 920 Score = 40.8 bits (94), Expect(2) = 3e-06 Identities = 28/69 (40%), Positives = 41/69 (59%), Gaps = 15/69 (21%) Frame = -1 Query: 321 LITPNELQEALANSE*KASW------LRKWKFYESI-LPKRKK--------ILKHKEDDS 187 ++ PN +Q+ALA+ KA+ L+K + +E + P RKK I+K+K DDS Sbjct: 452 VVIPNSMQKALADPRWKATMNEEMKSLQKNETWELVECPPRKKPVGCRWIYIVKYKADDS 511 Query: 186 VERFKIRLV 160 +ERFK RLV Sbjct: 512 IERFKARLV 520 Score = 35.8 bits (81), Expect(2) = 3e-06 Identities = 17/23 (73%), Positives = 20/23 (86%) Frame = -2 Query: 137 IRVLLPLAANLECSLQQFDVKKS 69 +RVLL LAANL+ SLQQFDVK + Sbjct: 545 VRVLLSLAANLDWSLQQFDVKNA 567