BLASTX nr result
ID: Paeonia25_contig00028170
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00028170 (414 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007211395.1| hypothetical protein PRUPE_ppa003337mg [Prun... 70 4e-10 ref|XP_007022159.1| Cationic amino acid transporter 8 [Theobroma... 69 9e-10 ref|XP_006477927.1| PREDICTED: cationic amino acid transporter 8... 68 1e-09 gb|EYU45055.1| hypothetical protein MIMGU_mgv1a003403mg [Mimulus... 68 2e-09 ref|XP_004251831.1| PREDICTED: cationic amino acid transporter 8... 68 2e-09 ref|XP_002300432.2| cationic amino acid transporter 8 family pro... 67 3e-09 ref|XP_006349994.1| PREDICTED: cationic amino acid transporter 8... 65 1e-08 ref|XP_004164930.1| PREDICTED: cationic amino acid transporter 8... 63 4e-08 ref|XP_004137314.1| PREDICTED: cationic amino acid transporter 8... 63 4e-08 ref|XP_004301950.1| PREDICTED: cationic amino acid transporter 8... 63 5e-08 ref|XP_002890204.1| hypothetical protein ARALYDRAFT_471910 [Arab... 61 2e-07 ref|XP_006307083.1| hypothetical protein CARUB_v10008669mg [Caps... 60 2e-07 emb|CBI27075.3| unnamed protein product [Vitis vinifera] 60 4e-07 ref|NP_173155.1| cationic amino acid transporter 8 [Arabidopsis ... 60 4e-07 ref|XP_007138860.1| hypothetical protein PHAVU_009G243600g [Phas... 59 5e-07 ref|XP_003533631.1| PREDICTED: cationic amino acid transporter 5... 59 7e-07 ref|XP_002518795.1| cationic amino acid transporter, putative [R... 59 7e-07 ref|XP_007138855.1| hypothetical protein PHAVU_009G243100g [Phas... 59 9e-07 ref|XP_006416741.1| hypothetical protein EUTSA_v10007175mg [Eutr... 59 9e-07 ref|XP_002278606.1| PREDICTED: uncharacterized amino acid permea... 59 9e-07 >ref|XP_007211395.1| hypothetical protein PRUPE_ppa003337mg [Prunus persica] gi|462407260|gb|EMJ12594.1| hypothetical protein PRUPE_ppa003337mg [Prunus persica] Length = 584 Score = 69.7 bits (169), Expect = 4e-10 Identities = 30/45 (66%), Positives = 39/45 (86%) Frame = +2 Query: 2 YVAFLRFFICSAVILVYYMLFGLHATYDVAHQDERESEIEQGKEN 136 YVAFLRFFIC+AV++ YY+L G+HATYDVAH E+ES+ E+G E+ Sbjct: 538 YVAFLRFFICTAVMVAYYLLVGVHATYDVAHHIEQESKTEEGNES 582 >ref|XP_007022159.1| Cationic amino acid transporter 8 [Theobroma cacao] gi|508721787|gb|EOY13684.1| Cationic amino acid transporter 8 [Theobroma cacao] Length = 693 Score = 68.6 bits (166), Expect = 9e-10 Identities = 31/41 (75%), Positives = 37/41 (90%) Frame = +2 Query: 2 YVAFLRFFICSAVILVYYMLFGLHATYDVAHQDERESEIEQ 124 +VAFLRF ICSAV+LVYY+L GLHATYDVAHQ+E S+IE+ Sbjct: 538 FVAFLRFIICSAVMLVYYLLVGLHATYDVAHQNEEVSKIEE 578 >ref|XP_006477927.1| PREDICTED: cationic amino acid transporter 8, vacuolar-like [Citrus sinensis] Length = 618 Score = 68.2 bits (165), Expect = 1e-09 Identities = 30/42 (71%), Positives = 37/42 (88%) Frame = +2 Query: 2 YVAFLRFFICSAVILVYYMLFGLHATYDVAHQDERESEIEQG 127 Y+AFLRF ICSAV+LVYY+L GLHATYDVAHQ++ +S E+G Sbjct: 576 YLAFLRFIICSAVMLVYYLLVGLHATYDVAHQNQEKSNNEEG 617 >gb|EYU45055.1| hypothetical protein MIMGU_mgv1a003403mg [Mimulus guttatus] Length = 587 Score = 67.8 bits (164), Expect = 2e-09 Identities = 28/50 (56%), Positives = 42/50 (84%) Frame = +2 Query: 5 VAFLRFFICSAVILVYYMLFGLHATYDVAHQDERESEIEQGKENINQGAL 154 VA RFFICSA+++VYY+L G+HATYDVAH ++ + ++E+G ++N+GAL Sbjct: 538 VAIWRFFICSAIMMVYYVLAGVHATYDVAHMNQEQVKLEEGDGDLNKGAL 587 >ref|XP_004251831.1| PREDICTED: cationic amino acid transporter 8, vacuolar-like [Solanum lycopersicum] Length = 617 Score = 67.8 bits (164), Expect = 2e-09 Identities = 28/46 (60%), Positives = 41/46 (89%) Frame = +2 Query: 8 AFLRFFICSAVILVYYMLFGLHATYDVAHQDERESEIEQGKENINQ 145 AF RFFICSAV+L+YY+L G+HATYD+AH D+++S I++GK++ +Q Sbjct: 570 AFYRFFICSAVMLIYYVLVGVHATYDIAHPDKQKSLIDEGKDSSDQ 615 >ref|XP_002300432.2| cationic amino acid transporter 8 family protein [Populus trichocarpa] gi|550349203|gb|EEE85237.2| cationic amino acid transporter 8 family protein [Populus trichocarpa] Length = 604 Score = 67.0 bits (162), Expect = 3e-09 Identities = 27/43 (62%), Positives = 38/43 (88%) Frame = +2 Query: 2 YVAFLRFFICSAVILVYYMLFGLHATYDVAHQDERESEIEQGK 130 Y AFLRF ICSAV+++YY++ G+HATYDVAHQ+ +E+E E+G+ Sbjct: 562 YEAFLRFIICSAVMILYYLMIGVHATYDVAHQNPKETEAEEGR 604 >ref|XP_006349994.1| PREDICTED: cationic amino acid transporter 8, vacuolar-like [Solanum tuberosum] Length = 618 Score = 65.1 bits (157), Expect = 1e-08 Identities = 27/46 (58%), Positives = 39/46 (84%) Frame = +2 Query: 8 AFLRFFICSAVILVYYMLFGLHATYDVAHQDERESEIEQGKENINQ 145 AF RFFICS V+L+YY+L G+HATYD+AH D+++S I++GK + +Q Sbjct: 571 AFYRFFICSVVMLIYYVLVGVHATYDIAHPDKQKSVIDEGKGSSDQ 616 >ref|XP_004164930.1| PREDICTED: cationic amino acid transporter 8, vacuolar-like [Cucumis sativus] Length = 630 Score = 63.2 bits (152), Expect = 4e-08 Identities = 29/43 (67%), Positives = 36/43 (83%) Frame = +2 Query: 8 AFLRFFICSAVILVYYMLFGLHATYDVAHQDERESEIEQGKEN 136 AFLRFFICSAV+L+YY+ GLHATYDVAHQD S+ E+ K++ Sbjct: 547 AFLRFFICSAVMLLYYLFIGLHATYDVAHQDGLGSKNEEIKDD 589 >ref|XP_004137314.1| PREDICTED: cationic amino acid transporter 8, vacuolar-like [Cucumis sativus] Length = 594 Score = 63.2 bits (152), Expect = 4e-08 Identities = 29/43 (67%), Positives = 36/43 (83%) Frame = +2 Query: 8 AFLRFFICSAVILVYYMLFGLHATYDVAHQDERESEIEQGKEN 136 AFLRFFICSAV+L+YY+ GLHATYDVAHQD S+ E+ K++ Sbjct: 547 AFLRFFICSAVMLLYYLFIGLHATYDVAHQDGLGSKNEEIKDD 589 >ref|XP_004301950.1| PREDICTED: cationic amino acid transporter 8, vacuolar-like [Fragaria vesca subsp. vesca] Length = 587 Score = 62.8 bits (151), Expect = 5e-08 Identities = 28/43 (65%), Positives = 37/43 (86%), Gaps = 1/43 (2%) Frame = +2 Query: 2 YVAFLRFFICSAVILVYYMLFGLHATYDVAHQ-DERESEIEQG 127 YVAFLRF IC+AV++VYY+ G+HATYDVAHQ D+++S E+G Sbjct: 537 YVAFLRFAICTAVMIVYYLFVGVHATYDVAHQIDQQQSRTEEG 579 >ref|XP_002890204.1| hypothetical protein ARALYDRAFT_471910 [Arabidopsis lyrata subsp. lyrata] gi|297336046|gb|EFH66463.1| hypothetical protein ARALYDRAFT_471910 [Arabidopsis lyrata subsp. lyrata] Length = 585 Score = 60.8 bits (146), Expect = 2e-07 Identities = 27/40 (67%), Positives = 32/40 (80%) Frame = +2 Query: 2 YVAFLRFFICSAVILVYYMLFGLHATYDVAHQDERESEIE 121 YVAFLRF IC+ V+L+YY+ GLHATYDVAHQ ES+ E Sbjct: 543 YVAFLRFIICTMVMLLYYLFVGLHATYDVAHQPLEESKFE 582 >ref|XP_006307083.1| hypothetical protein CARUB_v10008669mg [Capsella rubella] gi|482575794|gb|EOA39981.1| hypothetical protein CARUB_v10008669mg [Capsella rubella] Length = 586 Score = 60.5 bits (145), Expect = 2e-07 Identities = 26/40 (65%), Positives = 32/40 (80%) Frame = +2 Query: 2 YVAFLRFFICSAVILVYYMLFGLHATYDVAHQDERESEIE 121 YVAFLRF IC+ V+LVYY+ GLHATYDVAHQ +++ E Sbjct: 544 YVAFLRFIICTMVMLVYYLFVGLHATYDVAHQPPEQAKFE 583 >emb|CBI27075.3| unnamed protein product [Vitis vinifera] Length = 885 Score = 59.7 bits (143), Expect = 4e-07 Identities = 33/65 (50%), Positives = 40/65 (61%) Frame = +2 Query: 2 YVAFLRFFICSAVILVYYMLFGLHATYDVAHQDERESEIEQGKENINQGAL*RGTKA*NF 181 Y AFLRFFICSAV+L+YY L GLHATYD+A + E + E N +L +A NF Sbjct: 526 YQAFLRFFICSAVMLIYYFLVGLHATYDMAPRTESRASNLGKNEEDNMSSL-AAARADNF 584 Query: 182 DYGME 196 Y E Sbjct: 585 YYPPE 589 >ref|NP_173155.1| cationic amino acid transporter 8 [Arabidopsis thaliana] gi|75313454|sp|Q9SHH0.1|CAAT8_ARATH RecName: Full=Cationic amino acid transporter 8, vacuolar gi|5734765|gb|AAD50030.1|AC007651_25 Very similar to amino acid transporter [Arabidopsis thaliana] gi|18176204|gb|AAL60003.1| putative amino acid transporter protein [Arabidopsis thaliana] gi|21436167|gb|AAM51371.1| putative amino acid transporter protein [Arabidopsis thaliana] gi|332191423|gb|AEE29544.1| cationic amino acid transporter 8 [Arabidopsis thaliana] Length = 590 Score = 59.7 bits (143), Expect = 4e-07 Identities = 26/40 (65%), Positives = 32/40 (80%) Frame = +2 Query: 2 YVAFLRFFICSAVILVYYMLFGLHATYDVAHQDERESEIE 121 YVAFLRF IC+ V+L+YY+ GLHATYDVAHQ E++ E Sbjct: 548 YVAFLRFIICTMVMLLYYLFVGLHATYDVAHQPLEEAKFE 587 >ref|XP_007138860.1| hypothetical protein PHAVU_009G243600g [Phaseolus vulgaris] gi|561011947|gb|ESW10854.1| hypothetical protein PHAVU_009G243600g [Phaseolus vulgaris] Length = 590 Score = 59.3 bits (142), Expect = 5e-07 Identities = 26/50 (52%), Positives = 38/50 (76%), Gaps = 1/50 (2%) Frame = +2 Query: 2 YVAFLRFFICSAVILVYYMLFGLHATYDVAHQDER-ESEIEQGKENINQG 148 Y AF+RF +C+ V+L+YY LFGLHATYD+AHQ E+ +S++ + N+G Sbjct: 540 YDAFIRFAVCTVVMLIYYFLFGLHATYDMAHQQEKLQSKLHHTETIKNEG 589 >ref|XP_003533631.1| PREDICTED: cationic amino acid transporter 5-like [Glycine max] Length = 589 Score = 58.9 bits (141), Expect = 7e-07 Identities = 23/35 (65%), Positives = 31/35 (88%) Frame = +2 Query: 2 YVAFLRFFICSAVILVYYMLFGLHATYDVAHQDER 106 Y AF+RF +C+ V+L+YY+LFGLHATYD+AHQ E+ Sbjct: 539 YEAFIRFGVCTVVMLIYYLLFGLHATYDMAHQQEK 573 >ref|XP_002518795.1| cationic amino acid transporter, putative [Ricinus communis] gi|223542176|gb|EEF43720.1| cationic amino acid transporter, putative [Ricinus communis] Length = 575 Score = 58.9 bits (141), Expect = 7e-07 Identities = 24/39 (61%), Positives = 34/39 (87%) Frame = +2 Query: 5 VAFLRFFICSAVILVYYMLFGLHATYDVAHQDERESEIE 121 VAF RF ICSAV+++YY+ G+HATYD+AHQ++ E++IE Sbjct: 535 VAFWRFIICSAVMILYYLFVGVHATYDLAHQNQEETKIE 573 >ref|XP_007138855.1| hypothetical protein PHAVU_009G243100g [Phaseolus vulgaris] gi|561011942|gb|ESW10849.1| hypothetical protein PHAVU_009G243100g [Phaseolus vulgaris] Length = 591 Score = 58.5 bits (140), Expect = 9e-07 Identities = 25/46 (54%), Positives = 33/46 (71%) Frame = +2 Query: 2 YVAFLRFFICSAVILVYYMLFGLHATYDVAHQDERESEIEQGKENI 139 Y AF+RF +C+ V+L+YY LFGLHATYD+AHQ E+ +E I Sbjct: 540 YEAFIRFGVCTVVMLIYYFLFGLHATYDMAHQQEKLQSKVDHRETI 585 >ref|XP_006416741.1| hypothetical protein EUTSA_v10007175mg [Eutrema salsugineum] gi|557094512|gb|ESQ35094.1| hypothetical protein EUTSA_v10007175mg [Eutrema salsugineum] Length = 584 Score = 58.5 bits (140), Expect = 9e-07 Identities = 26/40 (65%), Positives = 31/40 (77%) Frame = +2 Query: 2 YVAFLRFFICSAVILVYYMLFGLHATYDVAHQDERESEIE 121 YVAFLRF IC+ V+L+YY+ GLHATYDVAHQ S+ E Sbjct: 542 YVAFLRFIICTMVMLLYYLFVGLHATYDVAHQPMEGSKFE 581 >ref|XP_002278606.1| PREDICTED: uncharacterized amino acid permease YfnA-like [Vitis vinifera] Length = 571 Score = 58.5 bits (140), Expect = 9e-07 Identities = 25/35 (71%), Positives = 31/35 (88%) Frame = +2 Query: 2 YVAFLRFFICSAVILVYYMLFGLHATYDVAHQDER 106 Y AFLRFFICSAV+L+YY L GLHATYD+A Q+++ Sbjct: 536 YQAFLRFFICSAVMLIYYFLVGLHATYDMARQNQQ 570