BLASTX nr result
ID: Paeonia25_contig00028075
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00028075 (296 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMD35651.1| hypothetical protein CERSUDRAFT_116392 [Ceriporio... 64 2e-08 gb|EIW54836.1| hypothetical protein TRAVEDRAFT_30851 [Trametes v... 64 2e-08 ref|XP_007370490.1| hypothetical protein DICSQDRAFT_112614 [Dich... 64 2e-08 ref|XP_007272085.1| hypothetical protein FOMMEDRAFT_115230 [Fomi... 64 3e-08 gb|EPS98247.1| hypothetical protein FOMPIDRAFT_1126886 [Fomitops... 63 4e-08 ref|XP_001832273.2| transcription initiation factor TFIIE alpha ... 61 1e-07 gb|EPQ52268.1| hypothetical protein GLOTRDRAFT_140654 [Gloeophyl... 60 2e-07 ref|XP_007314004.1| hypothetical protein SERLADRAFT_458004 [Serp... 60 3e-07 gb|EIW78414.1| hypothetical protein CONPUDRAFT_138702 [Coniophor... 59 7e-07 ref|XP_007393012.1| hypothetical protein PHACADRAFT_251430 [Phan... 58 1e-06 ref|XP_006463473.1| hypothetical protein AGABI2DRAFT_208287 [Aga... 58 2e-06 ref|XP_007332060.1| hypothetical protein AGABI1DRAFT_130505 [Aga... 58 2e-06 ref|XP_001881310.1| predicted protein [Laccaria bicolor S238N-H8... 58 2e-06 gb|ETW77930.1| hypothetical protein HETIRDRAFT_126621 [Heterobas... 57 3e-06 emb|CCM04771.1| predicted protein [Fibroporia radiculosa] 57 4e-06 ref|XP_007302022.1| hypothetical protein STEHIDRAFT_154810 [Ster... 56 5e-06 >gb|EMD35651.1| hypothetical protein CERSUDRAFT_116392 [Ceriporiopsis subvermispora B] Length = 484 Score = 64.3 bits (155), Expect = 2e-08 Identities = 29/37 (78%), Positives = 34/37 (91%) Frame = +1 Query: 184 TLPKDDQDTLRILVQYVSRAFYEPKFIVVMDQLVRHP 294 TL KD+Q+ LR+LVQ+VSRAFYEPK+ VVMDQLVRHP Sbjct: 3 TLSKDEQEALRLLVQHVSRAFYEPKYTVVMDQLVRHP 39 >gb|EIW54836.1| hypothetical protein TRAVEDRAFT_30851 [Trametes versicolor FP-101664 SS1] Length = 481 Score = 64.3 bits (155), Expect = 2e-08 Identities = 29/36 (80%), Positives = 34/36 (94%) Frame = +1 Query: 187 LPKDDQDTLRILVQYVSRAFYEPKFIVVMDQLVRHP 294 L KD+Q+TLR+LVQ+VSRAFYEP+F VVMDQLVRHP Sbjct: 5 LSKDEQETLRLLVQHVSRAFYEPRFTVVMDQLVRHP 40 >ref|XP_007370490.1| hypothetical protein DICSQDRAFT_112614 [Dichomitus squalens LYAD-421 SS1] gi|395324368|gb|EJF56810.1| hypothetical protein DICSQDRAFT_112614 [Dichomitus squalens LYAD-421 SS1] Length = 484 Score = 63.9 bits (154), Expect = 2e-08 Identities = 28/36 (77%), Positives = 34/36 (94%) Frame = +1 Query: 187 LPKDDQDTLRILVQYVSRAFYEPKFIVVMDQLVRHP 294 L KD+Q+TLR+LVQ+VSRAFYEPKF VV+DQL+RHP Sbjct: 5 LSKDEQETLRLLVQHVSRAFYEPKFTVVLDQLIRHP 40 >ref|XP_007272085.1| hypothetical protein FOMMEDRAFT_115230 [Fomitiporia mediterranea MF3/22] gi|393212166|gb|EJC97668.1| hypothetical protein FOMMEDRAFT_115230 [Fomitiporia mediterranea MF3/22] Length = 522 Score = 63.5 bits (153), Expect = 3e-08 Identities = 26/34 (76%), Positives = 32/34 (94%) Frame = +1 Query: 193 KDDQDTLRILVQYVSRAFYEPKFIVVMDQLVRHP 294 K+DQ+ LR+LVQYVSRAFYEPKF+++MDQL RHP Sbjct: 4 KEDQENLRLLVQYVSRAFYEPKFVIIMDQLARHP 37 >gb|EPS98247.1| hypothetical protein FOMPIDRAFT_1126886 [Fomitopsis pinicola FP-58527 SS1] Length = 484 Score = 63.2 bits (152), Expect = 4e-08 Identities = 28/37 (75%), Positives = 34/37 (91%) Frame = +1 Query: 184 TLPKDDQDTLRILVQYVSRAFYEPKFIVVMDQLVRHP 294 +L KD+Q+TLR+LVQ+VSRAFYEPK+ VVMDQL RHP Sbjct: 3 SLSKDEQETLRLLVQHVSRAFYEPKYTVVMDQLARHP 39 >ref|XP_001832273.2| transcription initiation factor TFIIE alpha subunit [Coprinopsis cinerea okayama7#130] gi|298405041|gb|EAU89646.2| transcription initiation factor TFIIE alpha subunit [Coprinopsis cinerea okayama7#130] Length = 518 Score = 61.2 bits (147), Expect = 1e-07 Identities = 25/34 (73%), Positives = 33/34 (97%) Frame = +1 Query: 193 KDDQDTLRILVQYVSRAFYEPKFIVVMDQLVRHP 294 K++Q+TLR+LVQ+VSRAFYEPK+I++MDQL RHP Sbjct: 4 KEEQETLRLLVQHVSRAFYEPKYIIIMDQLARHP 37 >gb|EPQ52268.1| hypothetical protein GLOTRDRAFT_140654 [Gloeophyllum trabeum ATCC 11539] Length = 485 Score = 60.5 bits (145), Expect = 2e-07 Identities = 25/34 (73%), Positives = 33/34 (97%) Frame = +1 Query: 193 KDDQDTLRILVQYVSRAFYEPKFIVVMDQLVRHP 294 K++Q+TLR+LVQ+VSR+FYEPK+IV+MDQL RHP Sbjct: 4 KEEQETLRLLVQHVSRSFYEPKYIVIMDQLARHP 37 >ref|XP_007314004.1| hypothetical protein SERLADRAFT_458004 [Serpula lacrymans var. lacrymans S7.9] gi|336375502|gb|EGO03838.1| hypothetical protein SERLA73DRAFT_175515 [Serpula lacrymans var. lacrymans S7.3] gi|336388618|gb|EGO29762.1| hypothetical protein SERLADRAFT_458004 [Serpula lacrymans var. lacrymans S7.9] Length = 474 Score = 60.1 bits (144), Expect = 3e-07 Identities = 24/34 (70%), Positives = 32/34 (94%) Frame = +1 Query: 193 KDDQDTLRILVQYVSRAFYEPKFIVVMDQLVRHP 294 K++Q+TLR+L+Q+VSRAFYEPKF ++MDQL RHP Sbjct: 4 KEEQETLRLLIQHVSRAFYEPKFTIIMDQLARHP 37 >gb|EIW78414.1| hypothetical protein CONPUDRAFT_138702 [Coniophora puteana RWD-64-598 SS2] Length = 471 Score = 58.9 bits (141), Expect = 7e-07 Identities = 25/34 (73%), Positives = 31/34 (91%) Frame = +1 Query: 193 KDDQDTLRILVQYVSRAFYEPKFIVVMDQLVRHP 294 ++DQ+TLRILVQ+VSR FYEPKF +V+DQL RHP Sbjct: 4 REDQETLRILVQHVSRGFYEPKFSIVLDQLARHP 37 >ref|XP_007393012.1| hypothetical protein PHACADRAFT_251430 [Phanerochaete carnosa HHB-10118-sp] gi|409048186|gb|EKM57664.1| hypothetical protein PHACADRAFT_251430 [Phanerochaete carnosa HHB-10118-sp] Length = 491 Score = 58.2 bits (139), Expect = 1e-06 Identities = 26/36 (72%), Positives = 31/36 (86%) Frame = +1 Query: 187 LPKDDQDTLRILVQYVSRAFYEPKFIVVMDQLVRHP 294 L K+D +TL +LVQ+V RAFYEPK+ VVMDQLVRHP Sbjct: 5 LSKEDHETLHLLVQHVLRAFYEPKYTVVMDQLVRHP 40 >ref|XP_006463473.1| hypothetical protein AGABI2DRAFT_208287 [Agaricus bisporus var. bisporus H97] gi|426195399|gb|EKV45329.1| hypothetical protein AGABI2DRAFT_208287 [Agaricus bisporus var. bisporus H97] Length = 534 Score = 57.8 bits (138), Expect = 2e-06 Identities = 23/33 (69%), Positives = 32/33 (96%) Frame = +1 Query: 193 KDDQDTLRILVQYVSRAFYEPKFIVVMDQLVRH 291 K+DQ+TLR+LVQ+V+RAFYEPK+I+++DQL RH Sbjct: 4 KEDQETLRLLVQHVARAFYEPKYIIILDQLARH 36 >ref|XP_007332060.1| hypothetical protein AGABI1DRAFT_130505 [Agaricus bisporus var. burnettii JB137-S8] gi|409077055|gb|EKM77423.1| hypothetical protein AGABI1DRAFT_130505 [Agaricus bisporus var. burnettii JB137-S8] Length = 533 Score = 57.8 bits (138), Expect = 2e-06 Identities = 23/33 (69%), Positives = 32/33 (96%) Frame = +1 Query: 193 KDDQDTLRILVQYVSRAFYEPKFIVVMDQLVRH 291 K+DQ+TLR+LVQ+V+RAFYEPK+I+++DQL RH Sbjct: 4 KEDQETLRLLVQHVARAFYEPKYIIILDQLARH 36 >ref|XP_001881310.1| predicted protein [Laccaria bicolor S238N-H82] gi|164643989|gb|EDR08240.1| predicted protein [Laccaria bicolor S238N-H82] Length = 490 Score = 57.8 bits (138), Expect = 2e-06 Identities = 24/34 (70%), Positives = 31/34 (91%) Frame = +1 Query: 193 KDDQDTLRILVQYVSRAFYEPKFIVVMDQLVRHP 294 K+DQ+TLR+LVQ+VSRAFYE KF +++DQL RHP Sbjct: 4 KEDQETLRLLVQHVSRAFYEAKFTIILDQLARHP 37 >gb|ETW77930.1| hypothetical protein HETIRDRAFT_126621 [Heterobasidion irregulare TC 32-1] Length = 511 Score = 57.0 bits (136), Expect = 3e-06 Identities = 26/32 (81%), Positives = 29/32 (90%) Frame = +1 Query: 196 DDQDTLRILVQYVSRAFYEPKFIVVMDQLVRH 291 +D+ LR+LVQYVSRAFYEPKFIVVMDQL RH Sbjct: 5 EDKAALRLLVQYVSRAFYEPKFIVVMDQLARH 36 >emb|CCM04771.1| predicted protein [Fibroporia radiculosa] Length = 495 Score = 56.6 bits (135), Expect = 4e-06 Identities = 26/33 (78%), Positives = 31/33 (93%) Frame = +1 Query: 184 TLPKDDQDTLRILVQYVSRAFYEPKFIVVMDQL 282 TL KD+Q+TLR+LVQ+VSRAFYEPK+ VVMDQL Sbjct: 3 TLNKDEQETLRLLVQHVSRAFYEPKYTVVMDQL 35 >ref|XP_007302022.1| hypothetical protein STEHIDRAFT_154810 [Stereum hirsutum FP-91666 SS1] gi|389747948|gb|EIM89126.1| hypothetical protein STEHIDRAFT_154810 [Stereum hirsutum FP-91666 SS1] Length = 509 Score = 56.2 bits (134), Expect = 5e-06 Identities = 25/35 (71%), Positives = 32/35 (91%) Frame = +1 Query: 187 LPKDDQDTLRILVQYVSRAFYEPKFIVVMDQLVRH 291 + ++++ TLR+LVQ+VSRAFYEPKFIVVMDQL RH Sbjct: 2 ITEEEKATLRLLVQHVSRAFYEPKFIVVMDQLARH 36