BLASTX nr result
ID: Paeonia25_contig00027317
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00027317 (218 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002307567.2| hypothetical protein POPTR_0005s22800g [Popu... 54 5e-07 >ref|XP_002307567.2| hypothetical protein POPTR_0005s22800g [Populus trichocarpa] gi|550339559|gb|EEE94563.2| hypothetical protein POPTR_0005s22800g [Populus trichocarpa] Length = 915 Score = 53.5 bits (127), Expect(2) = 5e-07 Identities = 29/53 (54%), Positives = 40/53 (75%), Gaps = 1/53 (1%) Frame = +3 Query: 3 TKEVEGLSLDLPGSSKLFS-RAFKEMTRLRLLALNRQNIKGSCKHISKELKWL 158 TK VEGL L+LPG + FS +AFK+M +LRLL LN ++GS ++IS +L+WL Sbjct: 311 TKAVEGLILNLPGLKQSFSTKAFKKMKKLRLLQLNCICLEGSYEYISTKLRWL 363 Score = 25.8 bits (55), Expect(2) = 5e-07 Identities = 11/16 (68%), Positives = 14/16 (87%) Frame = +1 Query: 169 DLHLENVVALDMRNSS 216 DL+LE ++ALDMR SS Sbjct: 376 DLYLETLIALDMRYSS 391