BLASTX nr result
ID: Paeonia25_contig00027292
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00027292 (250 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002285417.2| PREDICTED: proteasome subunit beta type-7-B ... 58 1e-06 ref|XP_002285415.1| PREDICTED: proteasome subunit beta type-7-B ... 58 1e-06 ref|XP_007160944.1| hypothetical protein PHAVU_001G030300g [Phas... 55 8e-06 >ref|XP_002285417.2| PREDICTED: proteasome subunit beta type-7-B isoform 2 [Vitis vinifera] Length = 267 Score = 58.2 bits (139), Expect = 1e-06 Identities = 29/38 (76%), Positives = 34/38 (89%), Gaps = 1/38 (2%) Frame = +3 Query: 3 FVNPKGYSFPKPIEVLSTKISQLKEKV-VIEGGEAMEE 113 +V+ KGYSFPKPIEVL TK++ LKEKV VIEGG+AMEE Sbjct: 230 YVSAKGYSFPKPIEVLLTKVTPLKEKVEVIEGGDAMEE 267 >ref|XP_002285415.1| PREDICTED: proteasome subunit beta type-7-B isoform 1 [Vitis vinifera] gi|296081387|emb|CBI16820.3| unnamed protein product [Vitis vinifera] Length = 273 Score = 58.2 bits (139), Expect = 1e-06 Identities = 29/38 (76%), Positives = 34/38 (89%), Gaps = 1/38 (2%) Frame = +3 Query: 3 FVNPKGYSFPKPIEVLSTKISQLKEKV-VIEGGEAMEE 113 +V+ KGYSFPKPIEVL TK++ LKEKV VIEGG+AMEE Sbjct: 236 YVSAKGYSFPKPIEVLLTKVTPLKEKVEVIEGGDAMEE 273 >ref|XP_007160944.1| hypothetical protein PHAVU_001G030300g [Phaseolus vulgaris] gi|561034408|gb|ESW32938.1| hypothetical protein PHAVU_001G030300g [Phaseolus vulgaris] Length = 271 Score = 55.5 bits (132), Expect = 8e-06 Identities = 26/37 (70%), Positives = 31/37 (83%) Frame = +3 Query: 3 FVNPKGYSFPKPIEVLSTKISQLKEKVVIEGGEAMEE 113 +VNPKG+ FPK IEVLSTKI+ LKEKV + G+AMEE Sbjct: 235 YVNPKGFEFPKKIEVLSTKITPLKEKVEVIEGDAMEE 271