BLASTX nr result
ID: Paeonia25_contig00027188
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00027188 (267 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CCM02258.1| predicted protein [Fibroporia radiculosa] 63 5e-08 gb|EMD42346.1| hypothetical protein CERSUDRAFT_148113 [Ceriporio... 58 2e-06 ref|XP_007324297.1| hypothetical protein SERLADRAFT_480253 [Serp... 57 4e-06 ref|XP_007359952.1| hypothetical protein DICSQDRAFT_48292 [Dicho... 55 8e-06 >emb|CCM02258.1| predicted protein [Fibroporia radiculosa] Length = 295 Score = 62.8 bits (151), Expect = 5e-08 Identities = 26/32 (81%), Positives = 30/32 (93%) Frame = -1 Query: 96 VPLPEGVEPISEADYFLKSDEFRVWLKEEKRK 1 +PLP GV PISE+DYFLKSDEFR+WLK+EKRK Sbjct: 29 IPLPSGVSPISESDYFLKSDEFRIWLKDEKRK 60 >gb|EMD42346.1| hypothetical protein CERSUDRAFT_148113 [Ceriporiopsis subvermispora B] Length = 302 Score = 57.8 bits (138), Expect = 2e-06 Identities = 24/32 (75%), Positives = 28/32 (87%) Frame = -1 Query: 96 VPLPEGVEPISEADYFLKSDEFRVWLKEEKRK 1 VP+P G PISE+DYFL+SDEFRVWLK+EK K Sbjct: 33 VPIPAGASPISESDYFLRSDEFRVWLKDEKHK 64 >ref|XP_007324297.1| hypothetical protein SERLADRAFT_480253 [Serpula lacrymans var. lacrymans S7.9] gi|336365352|gb|EGN93703.1| hypothetical protein SERLA73DRAFT_189439 [Serpula lacrymans var. lacrymans S7.3] gi|336377913|gb|EGO19073.1| hypothetical protein SERLADRAFT_480253 [Serpula lacrymans var. lacrymans S7.9] Length = 293 Score = 56.6 bits (135), Expect = 4e-06 Identities = 25/30 (83%), Positives = 27/30 (90%) Frame = -1 Query: 90 LPEGVEPISEADYFLKSDEFRVWLKEEKRK 1 LP GV+PISE DYFLKSDEFRVWLK+EK K Sbjct: 27 LPSGVDPISEKDYFLKSDEFRVWLKDEKGK 56 >ref|XP_007359952.1| hypothetical protein DICSQDRAFT_48292 [Dichomitus squalens LYAD-421 SS1] gi|395334994|gb|EJF67370.1| hypothetical protein DICSQDRAFT_48292 [Dichomitus squalens LYAD-421 SS1] Length = 295 Score = 55.5 bits (132), Expect = 8e-06 Identities = 25/30 (83%), Positives = 27/30 (90%) Frame = -1 Query: 90 LPEGVEPISEADYFLKSDEFRVWLKEEKRK 1 LP+GV ISE+DYFLKSDEFRVWLKEEK K Sbjct: 33 LPDGVSEISESDYFLKSDEFRVWLKEEKGK 62