BLASTX nr result
ID: Paeonia25_contig00027100
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00027100 (355 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMD36562.1| hypothetical protein CERSUDRAFT_124335 [Ceriporio... 59 7e-07 >gb|EMD36562.1| hypothetical protein CERSUDRAFT_124335 [Ceriporiopsis subvermispora B] Length = 596 Score = 58.9 bits (141), Expect = 7e-07 Identities = 24/32 (75%), Positives = 29/32 (90%) Frame = -2 Query: 354 LSRAWMREFGAGWRGRFEVHMLDRFAWDMLEV 259 LSRAWMREFG W+GRFE+HMLDR+A ++LEV Sbjct: 565 LSRAWMREFGEAWKGRFEIHMLDRYAVELLEV 596