BLASTX nr result
ID: Paeonia25_contig00026942
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00026942 (274 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMD34582.1| hypothetical protein CERSUDRAFT_116747 [Ceriporio... 67 2e-09 ref|XP_007394131.1| hypothetical protein PHACADRAFT_253318 [Phan... 67 3e-09 emb|CCM00453.1| predicted protein [Fibroporia radiculosa] 64 2e-08 ref|XP_007369128.1| hypothetical protein DICSQDRAFT_129072 [Dich... 64 3e-08 gb|EIW51679.1| hypothetical protein TRAVEDRAFT_75701 [Trametes v... 62 8e-08 gb|EPS93917.1| hypothetical protein FOMPIDRAFT_1033536 [Fomitops... 60 3e-07 ref|XP_007308842.1| hypothetical protein STEHIDRAFT_171509 [Ster... 58 2e-06 ref|XP_007313506.1| hypothetical protein SERLADRAFT_456804 [Serp... 57 3e-06 >gb|EMD34582.1| hypothetical protein CERSUDRAFT_116747 [Ceriporiopsis subvermispora B] Length = 359 Score = 67.4 bits (163), Expect = 2e-09 Identities = 29/43 (67%), Positives = 37/43 (86%) Frame = +3 Query: 114 EHHRWSEVIPPHTALSFAVIFEPDEGIVSFSGAQLLDAEPCSG 242 E+HRWSEVIPPHTAL+FA +++P EG+V+FSGA LLD+E G Sbjct: 9 ENHRWSEVIPPHTALTFAAVWDPAEGMVTFSGAHLLDSEEDKG 51 >ref|XP_007394131.1| hypothetical protein PHACADRAFT_253318 [Phanerochaete carnosa HHB-10118-sp] gi|409046798|gb|EKM56277.1| hypothetical protein PHACADRAFT_253318 [Phanerochaete carnosa HHB-10118-sp] Length = 395 Score = 67.0 bits (162), Expect = 3e-09 Identities = 28/41 (68%), Positives = 36/41 (87%) Frame = +3 Query: 108 EEEHHRWSEVIPPHTALSFAVIFEPDEGIVSFSGAQLLDAE 230 EE HRWSEVIPPHTALSFA ++P+EG+V+FSG +LL+A+ Sbjct: 2 EENSHRWSEVIPPHTALSFAAFWDPEEGLVTFSGGELLNAD 42 >emb|CCM00453.1| predicted protein [Fibroporia radiculosa] Length = 353 Score = 63.9 bits (154), Expect = 2e-08 Identities = 25/45 (55%), Positives = 38/45 (84%) Frame = +3 Query: 102 IKEEEHHRWSEVIPPHTALSFAVIFEPDEGIVSFSGAQLLDAEPC 236 +++ RWSE+IPPHTAL+FA +++P +G+++FSGAQLLD+E C Sbjct: 1 MQQPSDRRWSELIPPHTALTFAAVWDPVDGLITFSGAQLLDSEVC 45 >ref|XP_007369128.1| hypothetical protein DICSQDRAFT_129072 [Dichomitus squalens LYAD-421 SS1] gi|395325748|gb|EJF58166.1| hypothetical protein DICSQDRAFT_129072 [Dichomitus squalens LYAD-421 SS1] Length = 436 Score = 63.5 bits (153), Expect = 3e-08 Identities = 26/39 (66%), Positives = 34/39 (87%) Frame = +3 Query: 114 EHHRWSEVIPPHTALSFAVIFEPDEGIVSFSGAQLLDAE 230 EHHRWSE++PP TAL+FA I++ DEG+V+FSGA L D+E Sbjct: 29 EHHRWSELVPPRTALTFAAIWDEDEGMVTFSGAHLFDSE 67 >gb|EIW51679.1| hypothetical protein TRAVEDRAFT_75701 [Trametes versicolor FP-101664 SS1] Length = 437 Score = 62.0 bits (149), Expect = 8e-08 Identities = 27/61 (44%), Positives = 46/61 (75%), Gaps = 3/61 (4%) Frame = +3 Query: 96 LHIKEEEHH---RWSEVIPPHTALSFAVIFEPDEGIVSFSGAQLLDAEPCSGKVGTRFAM 266 +++K+ + H RWSE++PPH+AL+FA I++P+EG+V+FSGA LLD G++ + + + Sbjct: 1 MNLKDIDTHAERRWSELVPPHSALTFAAIWDPEEGMVTFSGAHLLDPPVDKGRIDSPYDV 60 Query: 267 S 269 S Sbjct: 61 S 61 >gb|EPS93917.1| hypothetical protein FOMPIDRAFT_1033536 [Fomitopsis pinicola FP-58527 SS1] Length = 403 Score = 60.1 bits (144), Expect = 3e-07 Identities = 24/42 (57%), Positives = 35/42 (83%) Frame = +3 Query: 105 KEEEHHRWSEVIPPHTALSFAVIFEPDEGIVSFSGAQLLDAE 230 ++ + RWSEV PPHTAL+FA +++P EG+++FSGA LLD+E Sbjct: 9 QQYDERRWSEVFPPHTALTFAAVWDPVEGMITFSGAHLLDSE 50 >ref|XP_007308842.1| hypothetical protein STEHIDRAFT_171509 [Stereum hirsutum FP-91666 SS1] gi|389740675|gb|EIM81865.1| hypothetical protein STEHIDRAFT_171509 [Stereum hirsutum FP-91666 SS1] Length = 710 Score = 57.8 bits (138), Expect = 2e-06 Identities = 21/40 (52%), Positives = 33/40 (82%) Frame = +3 Query: 120 HRWSEVIPPHTALSFAVIFEPDEGIVSFSGAQLLDAEPCS 239 HRWS+++PP TAL+FA +++P EG+++FSGA+LL + S Sbjct: 128 HRWSDIVPPQTALTFAAVYDPSEGLITFSGAELLPSSSSS 167 >ref|XP_007313506.1| hypothetical protein SERLADRAFT_456804 [Serpula lacrymans var. lacrymans S7.9] gi|336375178|gb|EGO03514.1| hypothetical protein SERLA73DRAFT_158137 [Serpula lacrymans var. lacrymans S7.3] gi|336388120|gb|EGO29264.1| hypothetical protein SERLADRAFT_456804 [Serpula lacrymans var. lacrymans S7.9] Length = 371 Score = 56.6 bits (135), Expect = 3e-06 Identities = 22/36 (61%), Positives = 33/36 (91%) Frame = +3 Query: 120 HRWSEVIPPHTALSFAVIFEPDEGIVSFSGAQLLDA 227 HRWS+V+PP +AL+FA +++P +G+V+FSGA+LLDA Sbjct: 42 HRWSDVVPPKSALTFAAVWDPKDGMVTFSGARLLDA 77