BLASTX nr result
ID: Paeonia25_contig00026559
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00026559 (236 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXC45069.1| Chloroplastic group IIA intron splicing facilitat... 119 4e-25 gb|EXB47734.1| Chloroplastic group IIA intron splicing facilitat... 119 4e-25 ref|XP_002517407.1| conserved hypothetical protein [Ricinus comm... 119 6e-25 ref|XP_002300024.2| hypothetical protein POPTR_0001s34720g [Popu... 117 1e-24 gb|EPS67538.1| hypothetical protein M569_07235, partial [Genlise... 117 1e-24 ref|XP_004489339.1| PREDICTED: chloroplastic group IIA intron sp... 117 1e-24 emb|CBI34982.3| unnamed protein product [Vitis vinifera] 117 1e-24 ref|XP_002275511.1| PREDICTED: chloroplastic group IIA intron sp... 117 1e-24 emb|CAN81271.1| hypothetical protein VITISV_006146 [Vitis vinifera] 117 1e-24 ref|XP_007217083.1| hypothetical protein PRUPE_ppa000515mg [Prun... 117 2e-24 ref|XP_003618343.1| Chloroplastic group IIA intron splicing faci... 117 2e-24 ref|XP_004297960.1| PREDICTED: uncharacterized protein LOC101297... 116 3e-24 gb|EYU44699.1| hypothetical protein MIMGU_mgv1a000630mg [Mimulus... 115 8e-24 ref|XP_006482481.1| PREDICTED: chloroplastic group IIA intron sp... 115 8e-24 ref|XP_006482480.1| PREDICTED: chloroplastic group IIA intron sp... 115 8e-24 ref|XP_006482479.1| PREDICTED: chloroplastic group IIA intron sp... 115 8e-24 ref|XP_006482478.1| PREDICTED: chloroplastic group IIA intron sp... 115 8e-24 ref|XP_006482476.1| PREDICTED: chloroplastic group IIA intron sp... 115 8e-24 ref|XP_006431007.1| hypothetical protein CICLE_v10013715mg [Citr... 115 8e-24 ref|XP_007031356.1| CRM family member 2, putative isoform 2 [The... 115 8e-24 >gb|EXC45069.1| Chloroplastic group IIA intron splicing facilitator CRS1 [Morus notabilis] Length = 966 Score = 119 bits (298), Expect = 4e-25 Identities = 55/60 (91%), Positives = 59/60 (98%) Frame = -1 Query: 182 AGITEGIVNGIHERWRRSEVVKIECEDLCRLNMKRTHDLLERKTGGLVVWRSGSIIVLYR 3 AGITEGIVNGIHERWR+SEVVKIECED+CR+NMKRTHDLLE+KTGGLVVWRSGS IVLYR Sbjct: 189 AGITEGIVNGIHERWRQSEVVKIECEDICRMNMKRTHDLLEKKTGGLVVWRSGSKIVLYR 248 >gb|EXB47734.1| Chloroplastic group IIA intron splicing facilitator CRS1 [Morus notabilis] Length = 449 Score = 119 bits (298), Expect = 4e-25 Identities = 55/60 (91%), Positives = 59/60 (98%) Frame = -1 Query: 182 AGITEGIVNGIHERWRRSEVVKIECEDLCRLNMKRTHDLLERKTGGLVVWRSGSIIVLYR 3 AGITEGIVNGIHERWR+SEVVKIECED+CR+NMKRTHDLLE+KTGGLVVWRSGS IVLYR Sbjct: 189 AGITEGIVNGIHERWRQSEVVKIECEDICRMNMKRTHDLLEKKTGGLVVWRSGSKIVLYR 248 >ref|XP_002517407.1| conserved hypothetical protein [Ricinus communis] gi|223543418|gb|EEF44949.1| conserved hypothetical protein [Ricinus communis] Length = 1009 Score = 119 bits (297), Expect = 6e-25 Identities = 56/60 (93%), Positives = 58/60 (96%) Frame = -1 Query: 182 AGITEGIVNGIHERWRRSEVVKIECEDLCRLNMKRTHDLLERKTGGLVVWRSGSIIVLYR 3 AGITEGIVNGIHERWRRSEVVKI CEDLCR+NMKRTHDLLERKTGGLVVWR+GS IVLYR Sbjct: 182 AGITEGIVNGIHERWRRSEVVKIVCEDLCRMNMKRTHDLLERKTGGLVVWRAGSKIVLYR 241 >ref|XP_002300024.2| hypothetical protein POPTR_0001s34720g [Populus trichocarpa] gi|550348879|gb|EEE84829.2| hypothetical protein POPTR_0001s34720g [Populus trichocarpa] Length = 453 Score = 117 bits (294), Expect = 1e-24 Identities = 56/60 (93%), Positives = 57/60 (95%) Frame = -1 Query: 182 AGITEGIVNGIHERWRRSEVVKIECEDLCRLNMKRTHDLLERKTGGLVVWRSGSIIVLYR 3 AGITEGIVNGIHERWRRSEVVKI CEDLCR+NMKRTHDLLERKTGGLVVWR GS IVLYR Sbjct: 186 AGITEGIVNGIHERWRRSEVVKIVCEDLCRMNMKRTHDLLERKTGGLVVWRVGSKIVLYR 245 >gb|EPS67538.1| hypothetical protein M569_07235, partial [Genlisea aurea] Length = 735 Score = 117 bits (294), Expect = 1e-24 Identities = 54/60 (90%), Positives = 58/60 (96%) Frame = -1 Query: 182 AGITEGIVNGIHERWRRSEVVKIECEDLCRLNMKRTHDLLERKTGGLVVWRSGSIIVLYR 3 AGITEGIVNGIHERWRRSEVVKI C+D+CRLNMKRTHDLLE+KTGGLVVWRSGS I+LYR Sbjct: 177 AGITEGIVNGIHERWRRSEVVKITCDDICRLNMKRTHDLLEKKTGGLVVWRSGSNIILYR 236 >ref|XP_004489339.1| PREDICTED: chloroplastic group IIA intron splicing facilitator CRS1, chloroplastic-like isoform X1 [Cicer arietinum] Length = 1019 Score = 117 bits (294), Expect = 1e-24 Identities = 54/60 (90%), Positives = 58/60 (96%) Frame = -1 Query: 182 AGITEGIVNGIHERWRRSEVVKIECEDLCRLNMKRTHDLLERKTGGLVVWRSGSIIVLYR 3 AGITEGIVNGIHERWRRSEVV+I CEDLCR+NMKRTHD+LERKTGGLVVWRSGS I+LYR Sbjct: 177 AGITEGIVNGIHERWRRSEVVRIVCEDLCRINMKRTHDILERKTGGLVVWRSGSKIILYR 236 >emb|CBI34982.3| unnamed protein product [Vitis vinifera] Length = 1028 Score = 117 bits (294), Expect = 1e-24 Identities = 52/60 (86%), Positives = 58/60 (96%) Frame = -1 Query: 182 AGITEGIVNGIHERWRRSEVVKIECEDLCRLNMKRTHDLLERKTGGLVVWRSGSIIVLYR 3 AGITEGIVNGIHERWRR+EVVKI CED+C+LNMKRTHD+LERKTGGLV+WRSGS I+LYR Sbjct: 210 AGITEGIVNGIHERWRRAEVVKIRCEDICKLNMKRTHDILERKTGGLVIWRSGSYIILYR 269 >ref|XP_002275511.1| PREDICTED: chloroplastic group IIA intron splicing facilitator CRS1, chloroplastic-like [Vitis vinifera] Length = 1044 Score = 117 bits (294), Expect = 1e-24 Identities = 52/60 (86%), Positives = 58/60 (96%) Frame = -1 Query: 182 AGITEGIVNGIHERWRRSEVVKIECEDLCRLNMKRTHDLLERKTGGLVVWRSGSIIVLYR 3 AGITEGIVNGIHERWRR+EVVKI CED+C+LNMKRTHD+LERKTGGLV+WRSGS I+LYR Sbjct: 210 AGITEGIVNGIHERWRRAEVVKIRCEDICKLNMKRTHDILERKTGGLVIWRSGSYIILYR 269 >emb|CAN81271.1| hypothetical protein VITISV_006146 [Vitis vinifera] Length = 1399 Score = 117 bits (294), Expect = 1e-24 Identities = 52/60 (86%), Positives = 58/60 (96%) Frame = -1 Query: 182 AGITEGIVNGIHERWRRSEVVKIECEDLCRLNMKRTHDLLERKTGGLVVWRSGSIIVLYR 3 AGITEGIVNGIHERWRR+EVVKI CED+C+LNMKRTHD+LERKTGGLV+WRSGS I+LYR Sbjct: 402 AGITEGIVNGIHERWRRAEVVKIRCEDICKLNMKRTHDILERKTGGLVIWRSGSYIILYR 461 >ref|XP_007217083.1| hypothetical protein PRUPE_ppa000515mg [Prunus persica] gi|462413233|gb|EMJ18282.1| hypothetical protein PRUPE_ppa000515mg [Prunus persica] Length = 1117 Score = 117 bits (293), Expect = 2e-24 Identities = 55/60 (91%), Positives = 57/60 (95%) Frame = -1 Query: 182 AGITEGIVNGIHERWRRSEVVKIECEDLCRLNMKRTHDLLERKTGGLVVWRSGSIIVLYR 3 AGITEGIVNGIHE WRRSEVVKI CEDLCR+NMKRTHD+LERKTGGLVVWRSGS IVLYR Sbjct: 187 AGITEGIVNGIHENWRRSEVVKIVCEDLCRMNMKRTHDMLERKTGGLVVWRSGSKIVLYR 246 >ref|XP_003618343.1| Chloroplastic group IIA intron splicing facilitator CRS1 [Medicago truncatula] gi|355493358|gb|AES74561.1| Chloroplastic group IIA intron splicing facilitator CRS1 [Medicago truncatula] Length = 1096 Score = 117 bits (292), Expect = 2e-24 Identities = 52/60 (86%), Positives = 58/60 (96%) Frame = -1 Query: 182 AGITEGIVNGIHERWRRSEVVKIECEDLCRLNMKRTHDLLERKTGGLVVWRSGSIIVLYR 3 AG+TEGIVNGIHERWRRSEVV++ CEDLCR+NMKRTHD+LERKTGGLVVWRSGS I+LYR Sbjct: 175 AGVTEGIVNGIHERWRRSEVVRVVCEDLCRINMKRTHDILERKTGGLVVWRSGSKIILYR 234 >ref|XP_004297960.1| PREDICTED: uncharacterized protein LOC101297928 [Fragaria vesca subsp. vesca] Length = 1169 Score = 116 bits (291), Expect = 3e-24 Identities = 54/60 (90%), Positives = 57/60 (95%) Frame = -1 Query: 182 AGITEGIVNGIHERWRRSEVVKIECEDLCRLNMKRTHDLLERKTGGLVVWRSGSIIVLYR 3 AGITEGIVNGIHE WRRSEVVK+ CEDLCRLNMKRTHDLLERKTGGLVVWRSG+ I+LYR Sbjct: 188 AGITEGIVNGIHENWRRSEVVKLVCEDLCRLNMKRTHDLLERKTGGLVVWRSGAKIILYR 247 >gb|EYU44699.1| hypothetical protein MIMGU_mgv1a000630mg [Mimulus guttatus] Length = 1040 Score = 115 bits (287), Expect = 8e-24 Identities = 52/60 (86%), Positives = 58/60 (96%) Frame = -1 Query: 182 AGITEGIVNGIHERWRRSEVVKIECEDLCRLNMKRTHDLLERKTGGLVVWRSGSIIVLYR 3 AGITEGIVNGIHERWRR+E+VKI CED+CRLNMKRTH+LLE+KTGGLVVWRSGS I+LYR Sbjct: 196 AGITEGIVNGIHERWRRTELVKITCEDICRLNMKRTHELLEKKTGGLVVWRSGSNIILYR 255 >ref|XP_006482481.1| PREDICTED: chloroplastic group IIA intron splicing facilitator CRS1, chloroplastic-like isoform X6 [Citrus sinensis] Length = 1031 Score = 115 bits (287), Expect = 8e-24 Identities = 54/60 (90%), Positives = 56/60 (93%) Frame = -1 Query: 182 AGITEGIVNGIHERWRRSEVVKIECEDLCRLNMKRTHDLLERKTGGLVVWRSGSIIVLYR 3 AGITEGIVNGIHERWR +EVVKI CEDLCRLNMKRTHD LERKTGGLVVWRSGS I+LYR Sbjct: 204 AGITEGIVNGIHERWRHAEVVKIVCEDLCRLNMKRTHDSLERKTGGLVVWRSGSKIILYR 263 >ref|XP_006482480.1| PREDICTED: chloroplastic group IIA intron splicing facilitator CRS1, chloroplastic-like isoform X5 [Citrus sinensis] Length = 1045 Score = 115 bits (287), Expect = 8e-24 Identities = 54/60 (90%), Positives = 56/60 (93%) Frame = -1 Query: 182 AGITEGIVNGIHERWRRSEVVKIECEDLCRLNMKRTHDLLERKTGGLVVWRSGSIIVLYR 3 AGITEGIVNGIHERWR +EVVKI CEDLCRLNMKRTHD LERKTGGLVVWRSGS I+LYR Sbjct: 204 AGITEGIVNGIHERWRHAEVVKIVCEDLCRLNMKRTHDSLERKTGGLVVWRSGSKIILYR 263 >ref|XP_006482479.1| PREDICTED: chloroplastic group IIA intron splicing facilitator CRS1, chloroplastic-like isoform X4 [Citrus sinensis] Length = 1050 Score = 115 bits (287), Expect = 8e-24 Identities = 54/60 (90%), Positives = 56/60 (93%) Frame = -1 Query: 182 AGITEGIVNGIHERWRRSEVVKIECEDLCRLNMKRTHDLLERKTGGLVVWRSGSIIVLYR 3 AGITEGIVNGIHERWR +EVVKI CEDLCRLNMKRTHD LERKTGGLVVWRSGS I+LYR Sbjct: 204 AGITEGIVNGIHERWRHAEVVKIVCEDLCRLNMKRTHDSLERKTGGLVVWRSGSKIILYR 263 >ref|XP_006482478.1| PREDICTED: chloroplastic group IIA intron splicing facilitator CRS1, chloroplastic-like isoform X3 [Citrus sinensis] Length = 1062 Score = 115 bits (287), Expect = 8e-24 Identities = 54/60 (90%), Positives = 56/60 (93%) Frame = -1 Query: 182 AGITEGIVNGIHERWRRSEVVKIECEDLCRLNMKRTHDLLERKTGGLVVWRSGSIIVLYR 3 AGITEGIVNGIHERWR +EVVKI CEDLCRLNMKRTHD LERKTGGLVVWRSGS I+LYR Sbjct: 204 AGITEGIVNGIHERWRHAEVVKIVCEDLCRLNMKRTHDSLERKTGGLVVWRSGSKIILYR 263 >ref|XP_006482476.1| PREDICTED: chloroplastic group IIA intron splicing facilitator CRS1, chloroplastic-like isoform X1 [Citrus sinensis] gi|568857850|ref|XP_006482477.1| PREDICTED: chloroplastic group IIA intron splicing facilitator CRS1, chloroplastic-like isoform X2 [Citrus sinensis] Length = 1076 Score = 115 bits (287), Expect = 8e-24 Identities = 54/60 (90%), Positives = 56/60 (93%) Frame = -1 Query: 182 AGITEGIVNGIHERWRRSEVVKIECEDLCRLNMKRTHDLLERKTGGLVVWRSGSIIVLYR 3 AGITEGIVNGIHERWR +EVVKI CEDLCRLNMKRTHD LERKTGGLVVWRSGS I+LYR Sbjct: 204 AGITEGIVNGIHERWRHAEVVKIVCEDLCRLNMKRTHDSLERKTGGLVVWRSGSKIILYR 263 >ref|XP_006431007.1| hypothetical protein CICLE_v10013715mg [Citrus clementina] gi|557533064|gb|ESR44247.1| hypothetical protein CICLE_v10013715mg [Citrus clementina] Length = 1062 Score = 115 bits (287), Expect = 8e-24 Identities = 54/60 (90%), Positives = 56/60 (93%) Frame = -1 Query: 182 AGITEGIVNGIHERWRRSEVVKIECEDLCRLNMKRTHDLLERKTGGLVVWRSGSIIVLYR 3 AGITEGIVNGIHERWR +EVVKI CEDLCRLNMKRTHD LERKTGGLVVWRSGS I+LYR Sbjct: 204 AGITEGIVNGIHERWRHAEVVKIVCEDLCRLNMKRTHDSLERKTGGLVVWRSGSKIILYR 263 >ref|XP_007031356.1| CRM family member 2, putative isoform 2 [Theobroma cacao] gi|508710385|gb|EOY02282.1| CRM family member 2, putative isoform 2 [Theobroma cacao] Length = 1045 Score = 115 bits (287), Expect = 8e-24 Identities = 52/60 (86%), Positives = 58/60 (96%) Frame = -1 Query: 182 AGITEGIVNGIHERWRRSEVVKIECEDLCRLNMKRTHDLLERKTGGLVVWRSGSIIVLYR 3 AGITEGIVNGIHERWRRSEVVKI CED+C++NMKRTH++LERKTGGLVVWRSGS I+LYR Sbjct: 190 AGITEGIVNGIHERWRRSEVVKIVCEDICKMNMKRTHEVLERKTGGLVVWRSGSKIILYR 249