BLASTX nr result
ID: Paeonia25_contig00026519
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00026519 (257 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXB29523.1| Putative calcium-transporting ATPase 13, plasma m... 65 1e-08 >gb|EXB29523.1| Putative calcium-transporting ATPase 13, plasma membrane-type [Morus notabilis] Length = 1081 Score = 64.7 bits (156), Expect = 1e-08 Identities = 35/79 (44%), Positives = 47/79 (59%), Gaps = 9/79 (11%) Frame = +3 Query: 3 ILADSARLNCEQWAVCFLIGTGSWVIHLTGKCTWEFIENW---------ISMVTSAPLES 155 IL D+ARL+ QW+VCFLIG GS ++ L KC +EF++NW +M S+ +S Sbjct: 1003 ILVDNARLSLVQWSVCFLIGIGSCLVDLAAKCGFEFVKNWKFCSHVGSSATMTHSSSSDS 1062 Query: 156 TSNLELPLIKEEFTAITSS 212 SNLEL LI + SS Sbjct: 1063 VSNLELRLITTSNSTSMSS 1081