BLASTX nr result
ID: Paeonia25_contig00026000
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00026000 (543 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007367819.1| hypothetical protein DICSQDRAFT_65039 [Dicho... 59 8e-07 gb|ETW76536.1| hypothetical protein HETIRDRAFT_421978 [Heterobas... 57 3e-06 emb|CCM02730.1| predicted protein [Fibroporia radiculosa] 57 4e-06 ref|XP_007400551.1| hypothetical protein PHACADRAFT_213243 [Phan... 55 8e-06 >ref|XP_007367819.1| hypothetical protein DICSQDRAFT_65039 [Dichomitus squalens LYAD-421 SS1] gi|395327037|gb|EJF59440.1| hypothetical protein DICSQDRAFT_65039 [Dichomitus squalens LYAD-421 SS1] Length = 661 Score = 58.9 bits (141), Expect = 8e-07 Identities = 28/40 (70%), Positives = 34/40 (85%), Gaps = 1/40 (2%) Frame = -2 Query: 350 GGREG-AVVLTPRDLLALDLGPFSALDARFVEWLGEVYFG 234 G REG AV+LTP+D+++ +LGPFS LDARFVEWLGE Y G Sbjct: 601 GVREGGAVMLTPKDVISFELGPFSGLDARFVEWLGEEYGG 640 >gb|ETW76536.1| hypothetical protein HETIRDRAFT_421978 [Heterobasidion irregulare TC 32-1] Length = 604 Score = 57.0 bits (136), Expect = 3e-06 Identities = 23/40 (57%), Positives = 32/40 (80%) Frame = -2 Query: 353 PGGREGAVVLTPRDLLALDLGPFSALDARFVEWLGEVYFG 234 PG G++ LTPRD+L+ +LGP S+LDA+F+EWLG+ Y G Sbjct: 543 PGSGAGSIALTPRDVLSFELGPLSSLDAKFLEWLGDEYGG 582 >emb|CCM02730.1| predicted protein [Fibroporia radiculosa] Length = 617 Score = 56.6 bits (135), Expect = 4e-06 Identities = 24/39 (61%), Positives = 30/39 (76%) Frame = -2 Query: 350 GGREGAVVLTPRDLLALDLGPFSALDARFVEWLGEVYFG 234 G V+LTP+D+++ +LGPFS LDARFVEWLGE Y G Sbjct: 557 GESNSTVILTPKDVMSFELGPFSGLDARFVEWLGEEYGG 595 >ref|XP_007400551.1| hypothetical protein PHACADRAFT_213243 [Phanerochaete carnosa HHB-10118-sp] gi|409041925|gb|EKM51410.1| hypothetical protein PHACADRAFT_213243 [Phanerochaete carnosa HHB-10118-sp] Length = 683 Score = 55.5 bits (132), Expect = 8e-06 Identities = 25/37 (67%), Positives = 28/37 (75%) Frame = -2 Query: 350 GGREGAVVLTPRDLLALDLGPFSALDARFVEWLGEVY 240 G A+VLTPRDL++ DLGP S LD RFVEWL EVY Sbjct: 624 GSSAPAIVLTPRDLMSFDLGPLSGLDGRFVEWLVEVY 660