BLASTX nr result
ID: Paeonia25_contig00025979
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00025979 (218 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_190694.1| 20S proteasome alpha subunit PAD1 [Arabidopsis... 64 2e-08 emb|CAA73622.1| multicatalytic endopeptidase [Arabidopsis thalia... 64 2e-08 ref|XP_006393800.1| hypothetical protein EUTSA_v10004820mg [Eutr... 64 2e-08 ref|XP_006291736.1| hypothetical protein CARUB_v10017906mg [Caps... 64 2e-08 ref|NP_001030838.1| 20S proteasome alpha subunit PAD1 [Arabidop... 64 2e-08 ref|NP_201415.1| proteasome alpha subunit D2 [Arabidopsis thalia... 64 2e-08 ref|XP_002876077.1| multicatalytic endopeptidase [Arabidopsis ly... 64 2e-08 ref|XP_002865085.1| hypothetical protein ARALYDRAFT_920118 [Arab... 64 2e-08 gb|AAM64989.1| multicatalytic endopeptidase complex alpha chain ... 64 2e-08 gb|EXC35336.1| Proteasome subunit alpha type-7 [Morus notabilis] 63 4e-08 ref|NP_001234333.1| proteasome subunit alpha type-7 [Solanum lyc... 63 4e-08 ref|NP_001265921.1| proteasome subunit alpha type-7 [Cicer ariet... 63 4e-08 ref|XP_006665182.1| PREDICTED: proteasome subunit alpha type-7-A... 63 4e-08 ref|XP_006661483.1| PREDICTED: proteasome subunit alpha type-7-A... 63 4e-08 ref|XP_006659664.1| PREDICTED: proteasome subunit alpha type-7-A... 63 4e-08 ref|XP_006466980.1| PREDICTED: proteasome subunit alpha type-7-l... 63 4e-08 ref|XP_007156176.1| hypothetical protein PHAVU_003G264700g [Phas... 63 4e-08 ref|XP_006425420.1| hypothetical protein CICLE_v10026339mg [Citr... 63 4e-08 ref|XP_006425419.1| hypothetical protein CICLE_v10026339mg [Citr... 63 4e-08 ref|XP_006422617.1| hypothetical protein CICLE_v10029139mg [Citr... 63 4e-08 >ref|NP_190694.1| 20S proteasome alpha subunit PAD1 [Arabidopsis thaliana] gi|266839|sp|P30186.1|PSA7A_ARATH RecName: Full=Proteasome subunit alpha type-7-A; AltName: Full=20S proteasome alpha subunit D-1; AltName: Full=Proteasome component 6A; AltName: Full=Proteasome subunit alpha type-4; AltName: Full=TAS-G64 gi|16445|emb|CAA47298.1| proteosome alpha subunit [Arabidopsis thaliana] gi|3421080|gb|AAC32058.1| 20S proteasome subunit PAD1 [Arabidopsis thaliana] gi|6562278|emb|CAB62648.1| multicatalytic endopeptidase complex [Arabidopsis thaliana] gi|14596065|gb|AAK68760.1| multicatalytic endopeptidase complex [Arabidopsis thaliana] gi|15450441|gb|AAK96514.1| AT3g51260/F24M12_300 [Arabidopsis thaliana] gi|16974445|gb|AAL31226.1| AT3g51260/F24M12_300 [Arabidopsis thaliana] gi|20148239|gb|AAM10010.1| multicatalytic endopeptidase complex [Arabidopsis thaliana] gi|332645248|gb|AEE78769.1| 20S proteasome alpha subunit PAD1 [Arabidopsis thaliana] gi|742351|prf||2009376B proteasome:SUBUNIT=alpha Length = 250 Score = 64.3 bits (155), Expect = 2e-08 Identities = 31/32 (96%), Positives = 31/32 (96%) Frame = +1 Query: 1 RLTLEDPVTVEYITRCIAGLQQKYTQSGGVRP 96 RLTLEDPVTVEYITR IAGLQQKYTQSGGVRP Sbjct: 96 RLTLEDPVTVEYITRYIAGLQQKYTQSGGVRP 127 >emb|CAA73622.1| multicatalytic endopeptidase [Arabidopsis thaliana] gi|2511582|emb|CAA73623.1| multicatalytic endopeptidase [Arabidopsis thaliana] Length = 235 Score = 64.3 bits (155), Expect = 2e-08 Identities = 31/32 (96%), Positives = 31/32 (96%) Frame = +1 Query: 1 RLTLEDPVTVEYITRCIAGLQQKYTQSGGVRP 96 RLTLEDPVTVEYITR IAGLQQKYTQSGGVRP Sbjct: 96 RLTLEDPVTVEYITRYIAGLQQKYTQSGGVRP 127 >ref|XP_006393800.1| hypothetical protein EUTSA_v10004820mg [Eutrema salsugineum] gi|567135889|ref|XP_006393802.1| hypothetical protein EUTSA_v10004818mg [Eutrema salsugineum] gi|557090439|gb|ESQ31086.1| hypothetical protein EUTSA_v10004820mg [Eutrema salsugineum] gi|557090441|gb|ESQ31088.1| hypothetical protein EUTSA_v10004818mg [Eutrema salsugineum] Length = 250 Score = 64.3 bits (155), Expect = 2e-08 Identities = 31/32 (96%), Positives = 31/32 (96%) Frame = +1 Query: 1 RLTLEDPVTVEYITRCIAGLQQKYTQSGGVRP 96 RLTLEDPVTVEYITR IAGLQQKYTQSGGVRP Sbjct: 96 RLTLEDPVTVEYITRYIAGLQQKYTQSGGVRP 127 >ref|XP_006291736.1| hypothetical protein CARUB_v10017906mg [Capsella rubella] gi|482560443|gb|EOA24634.1| hypothetical protein CARUB_v10017906mg [Capsella rubella] Length = 250 Score = 64.3 bits (155), Expect = 2e-08 Identities = 31/32 (96%), Positives = 31/32 (96%) Frame = +1 Query: 1 RLTLEDPVTVEYITRCIAGLQQKYTQSGGVRP 96 RLTLEDPVTVEYITR IAGLQQKYTQSGGVRP Sbjct: 96 RLTLEDPVTVEYITRYIAGLQQKYTQSGGVRP 127 >ref|NP_001030838.1| 20S proteasome alpha subunit PAD1 [Arabidopsis thaliana] gi|332645249|gb|AEE78770.1| 20S proteasome alpha subunit PAD1 [Arabidopsis thaliana] Length = 243 Score = 64.3 bits (155), Expect = 2e-08 Identities = 31/32 (96%), Positives = 31/32 (96%) Frame = +1 Query: 1 RLTLEDPVTVEYITRCIAGLQQKYTQSGGVRP 96 RLTLEDPVTVEYITR IAGLQQKYTQSGGVRP Sbjct: 96 RLTLEDPVTVEYITRYIAGLQQKYTQSGGVRP 127 >ref|NP_201415.1| proteasome alpha subunit D2 [Arabidopsis thaliana] gi|12229893|sp|O24616.2|PSA7B_ARATH RecName: Full=Proteasome subunit alpha type-7-B; AltName: Full=20S proteasome alpha subunit D-2; AltName: Full=Proteasome component 6B; AltName: Full=Proteasome component 6C; AltName: Full=Proteasome subunit alpha type-4 gi|3421082|gb|AAC32059.1| 20S proteasome subunit PAD2 [Arabidopsis thaliana] gi|10177129|dbj|BAB10419.1| 20S proteasome subunit PAD2 [Arabidopsis thaliana] gi|332010781|gb|AED98164.1| proteasome alpha subunit D2 [Arabidopsis thaliana] Length = 250 Score = 64.3 bits (155), Expect = 2e-08 Identities = 31/32 (96%), Positives = 31/32 (96%) Frame = +1 Query: 1 RLTLEDPVTVEYITRCIAGLQQKYTQSGGVRP 96 RLTLEDPVTVEYITR IAGLQQKYTQSGGVRP Sbjct: 96 RLTLEDPVTVEYITRYIAGLQQKYTQSGGVRP 127 >ref|XP_002876077.1| multicatalytic endopeptidase [Arabidopsis lyrata subsp. lyrata] gi|297321915|gb|EFH52336.1| multicatalytic endopeptidase [Arabidopsis lyrata subsp. lyrata] Length = 251 Score = 64.3 bits (155), Expect = 2e-08 Identities = 31/32 (96%), Positives = 31/32 (96%) Frame = +1 Query: 1 RLTLEDPVTVEYITRCIAGLQQKYTQSGGVRP 96 RLTLEDPVTVEYITR IAGLQQKYTQSGGVRP Sbjct: 96 RLTLEDPVTVEYITRYIAGLQQKYTQSGGVRP 127 >ref|XP_002865085.1| hypothetical protein ARALYDRAFT_920118 [Arabidopsis lyrata subsp. lyrata] gi|297310920|gb|EFH41344.1| hypothetical protein ARALYDRAFT_920118 [Arabidopsis lyrata subsp. lyrata] Length = 250 Score = 64.3 bits (155), Expect = 2e-08 Identities = 31/32 (96%), Positives = 31/32 (96%) Frame = +1 Query: 1 RLTLEDPVTVEYITRCIAGLQQKYTQSGGVRP 96 RLTLEDPVTVEYITR IAGLQQKYTQSGGVRP Sbjct: 96 RLTLEDPVTVEYITRYIAGLQQKYTQSGGVRP 127 >gb|AAM64989.1| multicatalytic endopeptidase complex alpha chain [Arabidopsis thaliana] Length = 250 Score = 64.3 bits (155), Expect = 2e-08 Identities = 31/32 (96%), Positives = 31/32 (96%) Frame = +1 Query: 1 RLTLEDPVTVEYITRCIAGLQQKYTQSGGVRP 96 RLTLEDPVTVEYITR IAGLQQKYTQSGGVRP Sbjct: 96 RLTLEDPVTVEYITRYIAGLQQKYTQSGGVRP 127 >gb|EXC35336.1| Proteasome subunit alpha type-7 [Morus notabilis] Length = 239 Score = 63.2 bits (152), Expect = 4e-08 Identities = 30/32 (93%), Positives = 31/32 (96%) Frame = +1 Query: 1 RLTLEDPVTVEYITRCIAGLQQKYTQSGGVRP 96 RLT+EDPVTVEYITR IAGLQQKYTQSGGVRP Sbjct: 96 RLTVEDPVTVEYITRYIAGLQQKYTQSGGVRP 127 >ref|NP_001234333.1| proteasome subunit alpha type-7 [Solanum lycopersicum] gi|3334299|sp|O24030.1|PSA7_SOLLC RecName: Full=Proteasome subunit alpha type-7; AltName: Full=20S proteasome alpha subunit D; AltName: Full=20S proteasome subunit alpha-4 gi|2315211|emb|CAA74725.1| proteasome alpha subunit [Solanum lycopersicum] Length = 259 Score = 63.2 bits (152), Expect = 4e-08 Identities = 30/32 (93%), Positives = 31/32 (96%) Frame = +1 Query: 1 RLTLEDPVTVEYITRCIAGLQQKYTQSGGVRP 96 RLT+EDPVTVEYITR IAGLQQKYTQSGGVRP Sbjct: 96 RLTVEDPVTVEYITRYIAGLQQKYTQSGGVRP 127 >ref|NP_001265921.1| proteasome subunit alpha type-7 [Cicer arietinum] gi|12229936|sp|Q9SXU1.1|PSA7_CICAR RecName: Full=Proteasome subunit alpha type-7; AltName: Full=20S proteasome alpha subunit D; AltName: Full=20S proteasome subunit alpha-4 gi|4586592|dbj|BAA76428.1| multicatalytic endopeptidase complex [Cicer arietinum] Length = 249 Score = 63.2 bits (152), Expect = 4e-08 Identities = 30/32 (93%), Positives = 31/32 (96%) Frame = +1 Query: 1 RLTLEDPVTVEYITRCIAGLQQKYTQSGGVRP 96 RLT+EDPVTVEYITR IAGLQQKYTQSGGVRP Sbjct: 96 RLTVEDPVTVEYITRYIAGLQQKYTQSGGVRP 127 >ref|XP_006665182.1| PREDICTED: proteasome subunit alpha type-7-A-like, partial [Oryza brachyantha] Length = 134 Score = 63.2 bits (152), Expect = 4e-08 Identities = 30/32 (93%), Positives = 31/32 (96%) Frame = +1 Query: 1 RLTLEDPVTVEYITRCIAGLQQKYTQSGGVRP 96 RLT+EDPVTVEYITR IAGLQQKYTQSGGVRP Sbjct: 96 RLTVEDPVTVEYITRYIAGLQQKYTQSGGVRP 127 >ref|XP_006661483.1| PREDICTED: proteasome subunit alpha type-7-A-like [Oryza brachyantha] Length = 295 Score = 63.2 bits (152), Expect = 4e-08 Identities = 30/32 (93%), Positives = 31/32 (96%) Frame = +1 Query: 1 RLTLEDPVTVEYITRCIAGLQQKYTQSGGVRP 96 RLT+EDPVTVEYITR IAGLQQKYTQSGGVRP Sbjct: 142 RLTVEDPVTVEYITRYIAGLQQKYTQSGGVRP 173 >ref|XP_006659664.1| PREDICTED: proteasome subunit alpha type-7-A-like [Oryza brachyantha] Length = 249 Score = 63.2 bits (152), Expect = 4e-08 Identities = 30/32 (93%), Positives = 31/32 (96%) Frame = +1 Query: 1 RLTLEDPVTVEYITRCIAGLQQKYTQSGGVRP 96 RLT+EDPVTVEYITR IAGLQQKYTQSGGVRP Sbjct: 96 RLTVEDPVTVEYITRYIAGLQQKYTQSGGVRP 127 >ref|XP_006466980.1| PREDICTED: proteasome subunit alpha type-7-like [Citrus sinensis] Length = 249 Score = 63.2 bits (152), Expect = 4e-08 Identities = 30/32 (93%), Positives = 31/32 (96%) Frame = +1 Query: 1 RLTLEDPVTVEYITRCIAGLQQKYTQSGGVRP 96 RLT+EDPVTVEYITR IAGLQQKYTQSGGVRP Sbjct: 96 RLTVEDPVTVEYITRYIAGLQQKYTQSGGVRP 127 >ref|XP_007156176.1| hypothetical protein PHAVU_003G264700g [Phaseolus vulgaris] gi|561029530|gb|ESW28170.1| hypothetical protein PHAVU_003G264700g [Phaseolus vulgaris] Length = 249 Score = 63.2 bits (152), Expect = 4e-08 Identities = 30/32 (93%), Positives = 31/32 (96%) Frame = +1 Query: 1 RLTLEDPVTVEYITRCIAGLQQKYTQSGGVRP 96 RLT+EDPVTVEYITR IAGLQQKYTQSGGVRP Sbjct: 96 RLTVEDPVTVEYITRYIAGLQQKYTQSGGVRP 127 >ref|XP_006425420.1| hypothetical protein CICLE_v10026339mg [Citrus clementina] gi|557527410|gb|ESR38660.1| hypothetical protein CICLE_v10026339mg [Citrus clementina] Length = 199 Score = 63.2 bits (152), Expect = 4e-08 Identities = 30/32 (93%), Positives = 31/32 (96%) Frame = +1 Query: 1 RLTLEDPVTVEYITRCIAGLQQKYTQSGGVRP 96 RLT+EDPVTVEYITR IAGLQQKYTQSGGVRP Sbjct: 96 RLTVEDPVTVEYITRYIAGLQQKYTQSGGVRP 127 >ref|XP_006425419.1| hypothetical protein CICLE_v10026339mg [Citrus clementina] gi|557527409|gb|ESR38659.1| hypothetical protein CICLE_v10026339mg [Citrus clementina] Length = 249 Score = 63.2 bits (152), Expect = 4e-08 Identities = 30/32 (93%), Positives = 31/32 (96%) Frame = +1 Query: 1 RLTLEDPVTVEYITRCIAGLQQKYTQSGGVRP 96 RLT+EDPVTVEYITR IAGLQQKYTQSGGVRP Sbjct: 96 RLTVEDPVTVEYITRYIAGLQQKYTQSGGVRP 127 >ref|XP_006422617.1| hypothetical protein CICLE_v10029139mg [Citrus clementina] gi|568866834|ref|XP_006486753.1| PREDICTED: proteasome subunit alpha type-7-like [Citrus sinensis] gi|557524551|gb|ESR35857.1| hypothetical protein CICLE_v10029139mg [Citrus clementina] Length = 249 Score = 63.2 bits (152), Expect = 4e-08 Identities = 30/32 (93%), Positives = 31/32 (96%) Frame = +1 Query: 1 RLTLEDPVTVEYITRCIAGLQQKYTQSGGVRP 96 RLT+EDPVTVEYITR IAGLQQKYTQSGGVRP Sbjct: 96 RLTVEDPVTVEYITRYIAGLQQKYTQSGGVRP 127