BLASTX nr result
ID: Paeonia25_contig00025781
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00025781 (309 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EQB45493.1| hypothetical protein CGLO_15634 [Colletotrichum g... 56 5e-06 gb|EHY59160.1| hypothetical protein HMPREF1120_07158 [Exophiala ... 55 8e-06 >gb|EQB45493.1| hypothetical protein CGLO_15634 [Colletotrichum gloeosporioides Cg-14] Length = 566 Score = 56.2 bits (134), Expect = 5e-06 Identities = 28/51 (54%), Positives = 33/51 (64%) Frame = +2 Query: 155 MRLLDTKTKKLMNTGAQTPPYAILSHRWLEEEVTFQDIFRAEVYKMKGYAK 307 MRLL+ KT+KL P YA+LSHRW EEEVT QD+ M+GYAK Sbjct: 1 MRLLNVKTRKLEQYFNNIPNYAVLSHRWGEEEVTLQDLSSPACQLMRGYAK 51 >gb|EHY59160.1| hypothetical protein HMPREF1120_07158 [Exophiala dermatitidis NIH/UT8656] Length = 618 Score = 55.5 bits (132), Expect = 8e-06 Identities = 26/52 (50%), Positives = 36/52 (69%), Gaps = 1/52 (1%) Frame = +2 Query: 155 MRLLDTKTKKLMNT-GAQTPPYAILSHRWLEEEVTFQDIFRAEVYKMKGYAK 307 MRL++ +T +L QTPPYAILSHRW EEV++QD+ +++ KGY K Sbjct: 1 MRLINVRTMQLEEFHSGQTPPYAILSHRWESEEVSYQDMGAPKIFGKKGYGK 52