BLASTX nr result
ID: Paeonia25_contig00025773
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00025773 (281 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CCM00373.1| predicted protein [Fibroporia radiculosa] 64 2e-08 ref|XP_007304493.1| hypothetical protein STEHIDRAFT_97737 [Stere... 59 5e-07 gb|EIW58737.1| hypothetical protein TRAVEDRAFT_29223 [Trametes v... 58 2e-06 >emb|CCM00373.1| predicted protein [Fibroporia radiculosa] Length = 656 Score = 64.3 bits (155), Expect = 2e-08 Identities = 33/64 (51%), Positives = 41/64 (64%) Frame = +1 Query: 85 ASYYHVFSLPPELLDSLIPRAIVNQANAPSSADKSFDTSEPVPPPSALSSNVGSNARICN 264 A YYH+FSLP +LLD++IPR +VNQA A SS S+P SN+ + AR CN Sbjct: 4 APYYHIFSLPKDLLDTIIPRDVVNQAQASSSPHSESSASQP--------SNI-TGARACN 54 Query: 265 VCPG 276 VCPG Sbjct: 55 VCPG 58 >ref|XP_007304493.1| hypothetical protein STEHIDRAFT_97737 [Stereum hirsutum FP-91666 SS1] gi|389745701|gb|EIM86882.1| hypothetical protein STEHIDRAFT_97737 [Stereum hirsutum FP-91666 SS1] Length = 656 Score = 59.3 bits (142), Expect = 5e-07 Identities = 35/65 (53%), Positives = 39/65 (60%) Frame = +1 Query: 85 ASYYHVFSLPPELLDSLIPRAIVNQANAPSSADKSFDTSEPVPPPSALSSNVGSNARICN 264 AS YHVFSLPPELLD+L PR ++ Q N PS D S P P SS + AR CN Sbjct: 4 ASQYHVFSLPPELLDNLTPRNLITQ-NPPS------DISRPA-SPDPTSSQTTTGARACN 55 Query: 265 VCPGA 279 VC GA Sbjct: 56 VCLGA 60 >gb|EIW58737.1| hypothetical protein TRAVEDRAFT_29223 [Trametes versicolor FP-101664 SS1] Length = 668 Score = 57.8 bits (138), Expect = 2e-06 Identities = 30/67 (44%), Positives = 39/67 (58%) Frame = +1 Query: 79 MVASYYHVFSLPPELLDSLIPRAIVNQANAPSSADKSFDTSEPVPPPSALSSNVGSNARI 258 M S YH+FSLP E+LD+L+PR I NQ AP D++ P P P+A +R Sbjct: 1 MAQSQYHLFSLPQEILDTLVPRNIANQTTAP--PPPRTDSATPAPQPTA-------GSRA 51 Query: 259 CNVCPGA 279 CN+C GA Sbjct: 52 CNICLGA 58