BLASTX nr result
ID: Paeonia25_contig00025705
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00025705 (981 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_007068856.1| WD-40 repeat-containing protein [Calothrix s... 57 9e-06 >ref|YP_007068856.1| WD-40 repeat-containing protein [Calothrix sp. PCC 7507] gi|504944710|ref|WP_015131812.1| WD-40 repeat-containing protein [Calothrix sp. PCC 7507] gi|427353298|gb|AFY36022.1| WD-40 repeat-containing protein [Calothrix sp. PCC 7507] Length = 1713 Score = 57.4 bits (137), Expect = 9e-06 Identities = 30/85 (35%), Positives = 51/85 (60%) Frame = -3 Query: 976 KRITDTSMCRDNRLIVAGSKDRNVYVWDTQTGELLSLFCGNSEEVTSVHFHPTRNLIAIG 797 +R+T S D +++ +GS D+ + +W G+LL F G++EE+TSV+F P ++A G Sbjct: 1485 ERVTSVSFSPDGQMLASGSADKTIKLWRLADGKLLQTFKGDTEEITSVNFSPDGQMLASG 1544 Query: 796 YAYNGLLKLPFC*HFPVSYVKSIPG 722 +Y+ +KL S V+S+PG Sbjct: 1545 -SYDNTVKL---WRLDGSLVRSLPG 1565