BLASTX nr result
ID: Paeonia25_contig00025527
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00025527 (459 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPT01334.1| hypothetical protein FOMPIDRAFT_40806 [Fomitopsis... 55 8e-06 >gb|EPT01334.1| hypothetical protein FOMPIDRAFT_40806 [Fomitopsis pinicola FP-58527 SS1] Length = 240 Score = 55.5 bits (132), Expect = 8e-06 Identities = 23/53 (43%), Positives = 35/53 (66%) Frame = +2 Query: 299 SEEERAAAVDFRLNLLGMFGGIEQHKWDQAKWEAAVAKYKSRYTPAIIDAVFK 457 S EE AA DFR N+ +F + + KWDQA+W+ AVA++K+ + P ++D K Sbjct: 9 SPEELAAMNDFRTNIWSVFQPLYEDKWDQARWDTAVARFKAAHDPVVVDRFMK 61