BLASTX nr result
ID: Paeonia25_contig00024886
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00024886 (476 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003546757.2| PREDICTED: probable disease resistance prote... 57 3e-06 >ref|XP_003546757.2| PREDICTED: probable disease resistance protein At4g27220-like [Glycine max] Length = 1487 Score = 57.0 bits (136), Expect = 3e-06 Identities = 21/47 (44%), Positives = 36/47 (76%) Frame = +2 Query: 2 FSQLRQVKLNSLPKLKTFCSGNHSFEFSSLEILKLDGCPLMDEFSSG 142 F +L ++ LN+LP+L++FC G++ F F SL+I++L+ CP+M+ F G Sbjct: 947 FMKLEELTLNNLPRLRSFCQGSYDFRFPSLQIVRLENCPMMETFCQG 993