BLASTX nr result
ID: Paeonia25_contig00024578
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00024578 (692 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ETW76384.1| hypothetical protein HETIRDRAFT_421859 [Heterobas... 62 2e-07 >gb|ETW76384.1| hypothetical protein HETIRDRAFT_421859 [Heterobasidion irregulare TC 32-1] Length = 207 Score = 61.6 bits (148), Expect = 2e-07 Identities = 27/54 (50%), Positives = 37/54 (68%) Frame = +1 Query: 46 IPWDSMKSDTLRAVLRDLGAKPPAGKREDMLASLRGIEKNGLDAVMTDRDVAQE 207 IPWD +K+DTLR V RDLGA P KR+DM+ L +EK GLDA + + + ++ Sbjct: 5 IPWDQLKADTLRLVCRDLGATPGKRKRDDMIGFLNKVEKRGLDAALAELETEEK 58