BLASTX nr result
ID: Paeonia25_contig00024347
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00024347 (570 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAC95126.1| gag-pol polyprotein [Populus deltoides] 49 3e-06 gb|AGJ83729.1| gag-pol polyprotein, partial [Caragana korshinskii] 50 5e-06 >emb|CAC95126.1| gag-pol polyprotein [Populus deltoides] Length = 1382 Score = 48.5 bits (114), Expect(2) = 3e-06 Identities = 20/45 (44%), Positives = 29/45 (64%) Frame = -2 Query: 320 VFGCICFVMCHQGDHGKVSRQSIMCGLHSYNDAKKGYRCYDPISE 186 VFGC FV+ + K+S +S +C Y + KKGYRC+DPI++ Sbjct: 706 VFGCTYFVLHPHVERNKLSSRSAICVFLGYGEGKKGYRCFDPITQ 750 Score = 28.5 bits (62), Expect(2) = 3e-06 Identities = 16/38 (42%), Positives = 22/38 (57%), Gaps = 3/38 (7%) Frame = -3 Query: 163 FLERIPLYLILYY*REIHESELHYIDPFHDD---DISP 59 FLE IP + I + +S+L +IDPF +D D SP Sbjct: 760 FLEHIPFFSIPSTTHSLTKSDLIHIDPFSEDSGNDTSP 797 >gb|AGJ83729.1| gag-pol polyprotein, partial [Caragana korshinskii] Length = 732 Score = 49.7 bits (117), Expect(2) = 5e-06 Identities = 21/42 (50%), Positives = 27/42 (64%) Frame = -2 Query: 320 VFGCICFVMCHQGDHGKVSRQSIMCGLHSYNDAKKGYRCYDP 195 VFG CFV+ Q + K+S +S +C Y D +KGYRCYDP Sbjct: 222 VFGSTCFVLRPQVERSKLSSRSAICVFLGYGDGQKGYRCYDP 263 Score = 26.6 bits (57), Expect(2) = 5e-06 Identities = 14/32 (43%), Positives = 17/32 (53%) Frame = -3 Query: 163 FLERIPLYLILYY*REIHESELHYIDPFHDDD 68 FLE IP Y + SEL +IDPF +D Sbjct: 276 FLEHIPFYSFSSESSITNSSELTHIDPFGPND 307