BLASTX nr result
ID: Paeonia25_contig00024191
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00024191 (738 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXC24955.1| hypothetical protein L484_009241 [Morus notabilis] 57 7e-06 >gb|EXC24955.1| hypothetical protein L484_009241 [Morus notabilis] Length = 285 Score = 57.0 bits (136), Expect = 7e-06 Identities = 21/54 (38%), Positives = 36/54 (66%), Gaps = 1/54 (1%) Frame = +3 Query: 441 SSSELSKNVKFVNKVCRCGLKCSVKISESRDNPNRLYFCCPLK-NKCGYFEWWE 599 ++ ++ + F+N+ C+CG +KISES++NPN+L +CCP K + C + WE Sbjct: 150 TNKSCNEEITFLNRKCKCGKTADLKISESKENPNKLIYCCPKKGDGCNFLAMWE 203