BLASTX nr result
ID: Paeonia25_contig00024056
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00024056 (1157 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EIW54730.1| hypothetical protein TRAVEDRAFT_50871 [Trametes v... 60 1e-06 >gb|EIW54730.1| hypothetical protein TRAVEDRAFT_50871 [Trametes versicolor FP-101664 SS1] Length = 470 Score = 60.5 bits (145), Expect = 1e-06 Identities = 39/115 (33%), Positives = 60/115 (52%), Gaps = 1/115 (0%) Frame = +2 Query: 539 CDGFCKSRQPLFDSSREHVISLAATQDGTEAYEHDGRGSLTKTLVEILRGEPHMSCGDLL 718 CDG+C+ HV+S++A QD YE S+T LVE+LR +P+ C +L+ Sbjct: 355 CDGWCQVES----EPEVHVVSISACQDLQVTYETRDGKSMTTDLVELLRSDPYPRCRELV 410 Query: 719 GEVTRQLHQISLKRHQEFVELIDQHQGSPEVEQYLS-LLDTNNFQTPVLGSETLL 880 ++ +LH L HQ E QH + + + + LLD +NF P +GS+ L Sbjct: 411 QQLGHKLHGTILLVHQASKE---QHDKAKKKKTNVKRLLDGDNFSEPQIGSQHTL 462