BLASTX nr result
ID: Paeonia25_contig00023917
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00023917 (1248 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS61315.1| hypothetical protein M569_13482 [Genlisea aurea] 59 4e-06 >gb|EPS61315.1| hypothetical protein M569_13482 [Genlisea aurea] Length = 1566 Score = 58.9 bits (141), Expect = 4e-06 Identities = 24/66 (36%), Positives = 48/66 (72%) Frame = +1 Query: 1048 LDKCVLEAILAEKRKQHEEVAKIDAEVMKILAALREMELQLEILSAIDNRKCVFPLMKLF 1227 +D C+ A+ +K + E++KIDA +++++A +R+ E++LE+ S++D + + PL+K F Sbjct: 868 VDSCIEVALQRQKEQVSVEISKIDARILRLVAEMRQFEVKLELASSLDFQSLLIPLVKSF 927 Query: 1228 IRAKLE 1245 +RA+LE Sbjct: 928 LRARLE 933