BLASTX nr result
ID: Paeonia25_contig00022671
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00022671 (854 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI30669.3| unnamed protein product [Vitis vinifera] 97 6e-18 ref|XP_002274637.1| PREDICTED: 50S ribosomal protein L34, chloro... 97 6e-18 emb|CAN60201.1| hypothetical protein VITISV_036402 [Vitis vinifera] 97 6e-18 ref|XP_002317427.2| hypothetical protein POPTR_0011s07530g [Popu... 96 2e-17 ref|XP_004134668.1| PREDICTED: 50S ribosomal protein L34, chloro... 95 3e-17 ref|XP_004293930.1| PREDICTED: 50S ribosomal protein L34, chloro... 94 7e-17 ref|XP_007025416.1| 50S ribosomal protein L34 [Theobroma cacao] ... 93 1e-16 ref|XP_006415614.1| hypothetical protein EUTSA_v10008967mg [Eutr... 92 3e-16 ref|XP_002890790.1| ribosomal protein L34 family protein [Arabid... 92 3e-16 ref|XP_006303384.1| hypothetical protein CARUB_v10010533mg [Caps... 92 3e-16 ref|NP_174202.1| 50S ribosomal protein L34 [Arabidopsis thaliana... 92 3e-16 ref|XP_007212058.1| hypothetical protein PRUPE_ppa011477mg [Prun... 90 1e-15 sp|P82244.1|RK34_SPIOL RecName: Full=50S ribosomal protein L34, ... 89 3e-15 ref|XP_006467667.1| PREDICTED: 50S ribosomal protein L34, chloro... 88 4e-15 ref|XP_006449482.1| hypothetical protein CICLE_v10017015mg [Citr... 88 4e-15 ref|XP_002522558.1| 50S ribosomal protein L34, chloroplast precu... 88 4e-15 gb|EXB44996.1| 50S ribosomal protein L34 [Morus notabilis] 86 2e-14 ref|NP_001238013.1| uncharacterized protein LOC100500433 [Glycin... 86 2e-14 ref|NP_001235807.1| uncharacterized protein LOC100526907 [Glycin... 83 1e-13 ref|XP_004485884.1| PREDICTED: 50S ribosomal protein L34, chloro... 82 2e-13 >emb|CBI30669.3| unnamed protein product [Vitis vinifera] Length = 113 Score = 97.4 bits (241), Expect = 6e-18 Identities = 51/75 (68%), Positives = 58/75 (77%) Frame = -1 Query: 545 IGLKREKGRGLVVRAAGKAALCLTKRSRSRKSLARTHGFRRRMRTTSXXXXXXXXXXXXX 366 +G+++E+G GLVVRA GKAALC TKR+RSRKSLARTHGFRRRMRTTS Sbjct: 40 VGVRKERGHGLVVRA-GKAALCQTKRNRSRKSLARTHGFRRRMRTTSGRAVLKRRRAKGR 98 Query: 365 XILCTKSNPSSGKRA 321 +LCTKSNPSSGKRA Sbjct: 99 KVLCTKSNPSSGKRA 113 >ref|XP_002274637.1| PREDICTED: 50S ribosomal protein L34, chloroplastic-like [Vitis vinifera] Length = 148 Score = 97.4 bits (241), Expect = 6e-18 Identities = 51/75 (68%), Positives = 58/75 (77%) Frame = -1 Query: 545 IGLKREKGRGLVVRAAGKAALCLTKRSRSRKSLARTHGFRRRMRTTSXXXXXXXXXXXXX 366 +G+++E+G GLVVRA GKAALC TKR+RSRKSLARTHGFRRRMRTTS Sbjct: 75 VGVRKERGHGLVVRA-GKAALCQTKRNRSRKSLARTHGFRRRMRTTSGRAVLKRRRAKGR 133 Query: 365 XILCTKSNPSSGKRA 321 +LCTKSNPSSGKRA Sbjct: 134 KVLCTKSNPSSGKRA 148 >emb|CAN60201.1| hypothetical protein VITISV_036402 [Vitis vinifera] Length = 148 Score = 97.4 bits (241), Expect = 6e-18 Identities = 51/75 (68%), Positives = 58/75 (77%) Frame = -1 Query: 545 IGLKREKGRGLVVRAAGKAALCLTKRSRSRKSLARTHGFRRRMRTTSXXXXXXXXXXXXX 366 +G+++E+G GLVVRA GKAALC TKR+RSRKSLARTHGFRRRMRTTS Sbjct: 75 VGVRKERGHGLVVRA-GKAALCQTKRNRSRKSLARTHGFRRRMRTTSGRAVLKRRRAKGR 133 Query: 365 XILCTKSNPSSGKRA 321 +LCTKSNPSSGKRA Sbjct: 134 KVLCTKSNPSSGKRA 148 >ref|XP_002317427.2| hypothetical protein POPTR_0011s07530g [Populus trichocarpa] gi|550327876|gb|EEE98039.2| hypothetical protein POPTR_0011s07530g [Populus trichocarpa] Length = 160 Score = 95.5 bits (236), Expect = 2e-17 Identities = 51/73 (69%), Positives = 57/73 (78%) Frame = -1 Query: 545 IGLKREKGRGLVVRAAGKAALCLTKRSRSRKSLARTHGFRRRMRTTSXXXXXXXXXXXXX 366 IG++++ GRGLVVRA GKAALCLTKRSRSRKSLARTHGFRRRMRTTS Sbjct: 87 IGVRKDIGRGLVVRA-GKAALCLTKRSRSRKSLARTHGFRRRMRTTSGRAVLKRRRAKGR 145 Query: 365 XILCTKSNPSSGK 327 +LCTKSNP+SGK Sbjct: 146 KVLCTKSNPNSGK 158 >ref|XP_004134668.1| PREDICTED: 50S ribosomal protein L34, chloroplastic-like [Cucumis sativus] gi|449479241|ref|XP_004155546.1| PREDICTED: 50S ribosomal protein L34, chloroplastic-like [Cucumis sativus] Length = 155 Score = 95.1 bits (235), Expect = 3e-17 Identities = 51/76 (67%), Positives = 58/76 (76%) Frame = -1 Query: 548 QIGLKREKGRGLVVRAAGKAALCLTKRSRSRKSLARTHGFRRRMRTTSXXXXXXXXXXXX 369 ++G+ + KGRGLVVRA GKAALC TKR+RSRKSLARTHGFRRRMRTT+ Sbjct: 81 KVGVGQGKGRGLVVRA-GKAALCQTKRNRSRKSLARTHGFRRRMRTTNGRAVLKRRRAKG 139 Query: 368 XXILCTKSNPSSGKRA 321 +LCTKSNPSSGKRA Sbjct: 140 RKVLCTKSNPSSGKRA 155 >ref|XP_004293930.1| PREDICTED: 50S ribosomal protein L34, chloroplastic-like [Fragaria vesca subsp. vesca] Length = 150 Score = 94.0 bits (232), Expect = 7e-17 Identities = 50/75 (66%), Positives = 57/75 (76%) Frame = -1 Query: 545 IGLKREKGRGLVVRAAGKAALCLTKRSRSRKSLARTHGFRRRMRTTSXXXXXXXXXXXXX 366 IG+ R +G GLVVRA GKAALCLTKR++SRKSLARTHGFRRRMRTTS Sbjct: 77 IGVGRRRGSGLVVRA-GKAALCLTKRNKSRKSLARTHGFRRRMRTTSGRAMLKRRRAKGR 135 Query: 365 XILCTKSNPSSGKRA 321 +LCTK+NP+SGKRA Sbjct: 136 KVLCTKTNPNSGKRA 150 >ref|XP_007025416.1| 50S ribosomal protein L34 [Theobroma cacao] gi|508780782|gb|EOY28038.1| 50S ribosomal protein L34 [Theobroma cacao] Length = 158 Score = 93.2 bits (230), Expect = 1e-16 Identities = 50/74 (67%), Positives = 56/74 (75%) Frame = -1 Query: 542 GLKREKGRGLVVRAAGKAALCLTKRSRSRKSLARTHGFRRRMRTTSXXXXXXXXXXXXXX 363 G++ EK RGLVVRA GKAALC TKR+RSRKSLARTHGFRRRMRTTS Sbjct: 86 GVRNEKRRGLVVRA-GKAALCQTKRNRSRKSLARTHGFRRRMRTTSGRAVLKRRRAKGRK 144 Query: 362 ILCTKSNPSSGKRA 321 +LCTKSNP+SGKR+ Sbjct: 145 VLCTKSNPNSGKRS 158 >ref|XP_006415614.1| hypothetical protein EUTSA_v10008967mg [Eutrema salsugineum] gi|557093385|gb|ESQ33967.1| hypothetical protein EUTSA_v10008967mg [Eutrema salsugineum] Length = 160 Score = 92.0 bits (227), Expect = 3e-16 Identities = 51/74 (68%), Positives = 53/74 (71%) Frame = -1 Query: 542 GLKREKGRGLVVRAAGKAALCLTKRSRSRKSLARTHGFRRRMRTTSXXXXXXXXXXXXXX 363 G+ +K RGLVVRA GKAALC TKRSRSRKSLARTHGFRRRMRTTS Sbjct: 88 GMNGQKRRGLVVRA-GKAALCQTKRSRSRKSLARTHGFRRRMRTTSGRATIKRRRAKGRW 146 Query: 362 ILCTKSNPSSGKRA 321 LC KSNPSSGKRA Sbjct: 147 NLCPKSNPSSGKRA 160 >ref|XP_002890790.1| ribosomal protein L34 family protein [Arabidopsis lyrata subsp. lyrata] gi|297336632|gb|EFH67049.1| ribosomal protein L34 family protein [Arabidopsis lyrata subsp. lyrata] Length = 159 Score = 92.0 bits (227), Expect = 3e-16 Identities = 51/74 (68%), Positives = 53/74 (71%) Frame = -1 Query: 542 GLKREKGRGLVVRAAGKAALCLTKRSRSRKSLARTHGFRRRMRTTSXXXXXXXXXXXXXX 363 GL ++ RGLVVRA GKAALC TKRSRSRKSLARTHGFRRRMRTTS Sbjct: 87 GLNSQRHRGLVVRA-GKAALCQTKRSRSRKSLARTHGFRRRMRTTSGRATIKRRRAKGRW 145 Query: 362 ILCTKSNPSSGKRA 321 LC KSNPSSGKRA Sbjct: 146 NLCPKSNPSSGKRA 159 >ref|XP_006303384.1| hypothetical protein CARUB_v10010533mg [Capsella rubella] gi|482572095|gb|EOA36282.1| hypothetical protein CARUB_v10010533mg [Capsella rubella] Length = 156 Score = 91.7 bits (226), Expect = 3e-16 Identities = 51/74 (68%), Positives = 53/74 (71%) Frame = -1 Query: 542 GLKREKGRGLVVRAAGKAALCLTKRSRSRKSLARTHGFRRRMRTTSXXXXXXXXXXXXXX 363 GL ++ RGLVVRA GKAALC TKRSRSRKSLARTHGFRRRMRTTS Sbjct: 84 GLNGQRRRGLVVRA-GKAALCQTKRSRSRKSLARTHGFRRRMRTTSGRATIKRRRAKGRW 142 Query: 362 ILCTKSNPSSGKRA 321 LC KSNPSSGKRA Sbjct: 143 NLCPKSNPSSGKRA 156 >ref|NP_174202.1| 50S ribosomal protein L34 [Arabidopsis thaliana] gi|75311421|sp|Q9LP37.1|RK34_ARATH RecName: Full=50S ribosomal protein L34, chloroplastic; AltName: Full=CL34; Flags: Precursor gi|9502428|gb|AAF88127.1|AC021043_20 Putative ribosomal protein L34 [Arabidopsis thaliana] gi|17380840|gb|AAL36232.1| putative plastid ribosomal protein L34 precursor [Arabidopsis thaliana] gi|20259639|gb|AAM14176.1| putative plastid ribosomal protein L34 precursor [Arabidopsis thaliana] gi|21536900|gb|AAM61232.1| plastid ribosomal protein L34 precursor, putative [Arabidopsis thaliana] gi|332192918|gb|AEE31039.1| 50S ribosomal protein L34 [Arabidopsis thaliana] Length = 157 Score = 91.7 bits (226), Expect = 3e-16 Identities = 51/74 (68%), Positives = 53/74 (71%) Frame = -1 Query: 542 GLKREKGRGLVVRAAGKAALCLTKRSRSRKSLARTHGFRRRMRTTSXXXXXXXXXXXXXX 363 GL ++ RGLVVRA GKAALC TKRSRSRKSLARTHGFRRRMRTTS Sbjct: 85 GLNGQRRRGLVVRA-GKAALCQTKRSRSRKSLARTHGFRRRMRTTSGRATIKRRRAKGRW 143 Query: 362 ILCTKSNPSSGKRA 321 LC KSNPSSGKRA Sbjct: 144 NLCPKSNPSSGKRA 157 >ref|XP_007212058.1| hypothetical protein PRUPE_ppa011477mg [Prunus persica] gi|462407923|gb|EMJ13257.1| hypothetical protein PRUPE_ppa011477mg [Prunus persica] Length = 209 Score = 90.1 bits (222), Expect = 1e-15 Identities = 49/75 (65%), Positives = 55/75 (73%) Frame = -1 Query: 545 IGLKREKGRGLVVRAAGKAALCLTKRSRSRKSLARTHGFRRRMRTTSXXXXXXXXXXXXX 366 IG+ R + GLVV+A GKAALCLTKR+RSRKSLARTHGFRRRMRTT Sbjct: 136 IGVGRRRSSGLVVKA-GKAALCLTKRNRSRKSLARTHGFRRRMRTTGGRAMLKRRRAKGR 194 Query: 365 XILCTKSNPSSGKRA 321 ILCTK+NP+SGKRA Sbjct: 195 KILCTKTNPNSGKRA 209 >sp|P82244.1|RK34_SPIOL RecName: Full=50S ribosomal protein L34, chloroplastic; AltName: Full=CL34; Flags: Precursor gi|189096152|pdb|3BBO|4 Chain 4, Homology Model For The Spinach Chloroplast 50s Subunit Fitted To 9.4a Cryo-Em Map Of The 70s Chlororibosome gi|7578860|gb|AAF64157.1|AF238221_1 plastid ribosomal protein L34 precursor [Spinacia oleracea] Length = 152 Score = 88.6 bits (218), Expect = 3e-15 Identities = 50/76 (65%), Positives = 54/76 (71%) Frame = -1 Query: 542 GLKREKGRGLVVRAAGKAALCLTKRSRSRKSLARTHGFRRRMRTTSXXXXXXXXXXXXXX 363 G+ ++ R VVRA GKAALCLTKRSRSRKSLARTHGFR RM TTS Sbjct: 78 GVSTDRCRRFVVRA-GKAALCLTKRSRSRKSLARTHGFRLRMSTTSGRALLKRRRAKGRK 136 Query: 362 ILCTKSNPSSGKRASP 315 ILCTK+NPSSGKRASP Sbjct: 137 ILCTKTNPSSGKRASP 152 >ref|XP_006467667.1| PREDICTED: 50S ribosomal protein L34, chloroplastic-like [Citrus sinensis] Length = 161 Score = 88.2 bits (217), Expect = 4e-15 Identities = 48/74 (64%), Positives = 55/74 (74%) Frame = -1 Query: 542 GLKREKGRGLVVRAAGKAALCLTKRSRSRKSLARTHGFRRRMRTTSXXXXXXXXXXXXXX 363 G+++EK +GLVVRA GKAALC TKR+RSRKSLARTHGFRRRMRTTS Sbjct: 89 GVRKEKRQGLVVRA-GKAALCQTKRNRSRKSLARTHGFRRRMRTTSGRAILKRRRAKGRW 147 Query: 362 ILCTKSNPSSGKRA 321 +LC KS P+SGKRA Sbjct: 148 VLCPKSYPNSGKRA 161 >ref|XP_006449482.1| hypothetical protein CICLE_v10017015mg [Citrus clementina] gi|567914339|ref|XP_006449483.1| hypothetical protein CICLE_v10017015mg [Citrus clementina] gi|557552093|gb|ESR62722.1| hypothetical protein CICLE_v10017015mg [Citrus clementina] gi|557552094|gb|ESR62723.1| hypothetical protein CICLE_v10017015mg [Citrus clementina] Length = 161 Score = 88.2 bits (217), Expect = 4e-15 Identities = 47/75 (62%), Positives = 56/75 (74%) Frame = -1 Query: 545 IGLKREKGRGLVVRAAGKAALCLTKRSRSRKSLARTHGFRRRMRTTSXXXXXXXXXXXXX 366 +G++++K +GLVVRA GKAALC TKR+RSRKSLARTHGFRRRMRTTS Sbjct: 88 VGVRKQKRQGLVVRA-GKAALCQTKRNRSRKSLARTHGFRRRMRTTSGRAILKRRRAKGR 146 Query: 365 XILCTKSNPSSGKRA 321 +LC KS P+SGKRA Sbjct: 147 WVLCPKSYPNSGKRA 161 >ref|XP_002522558.1| 50S ribosomal protein L34, chloroplast precursor, putative [Ricinus communis] gi|223538249|gb|EEF39858.1| 50S ribosomal protein L34, chloroplast precursor, putative [Ricinus communis] Length = 161 Score = 88.2 bits (217), Expect = 4e-15 Identities = 47/72 (65%), Positives = 54/72 (75%) Frame = -1 Query: 542 GLKREKGRGLVVRAAGKAALCLTKRSRSRKSLARTHGFRRRMRTTSXXXXXXXXXXXXXX 363 G+++ +G GLVVRA GKAALC TKR+RSRKSLARTHGFRRRMRTTS Sbjct: 89 GVRKGRGYGLVVRA-GKAALCQTKRNRSRKSLARTHGFRRRMRTTSGRAVLKRRRAKGRK 147 Query: 362 ILCTKSNPSSGK 327 +LCTKSNP+SGK Sbjct: 148 VLCTKSNPNSGK 159 >gb|EXB44996.1| 50S ribosomal protein L34 [Morus notabilis] Length = 156 Score = 85.5 bits (210), Expect = 2e-14 Identities = 47/73 (64%), Positives = 52/73 (71%) Frame = -1 Query: 545 IGLKREKGRGLVVRAAGKAALCLTKRSRSRKSLARTHGFRRRMRTTSXXXXXXXXXXXXX 366 +G+ + RGLVVRA GK ALCLTKR+RSRKSLARTHGFRRRMRTTS Sbjct: 83 VGIGKGNRRGLVVRA-GKPALCLTKRNRSRKSLARTHGFRRRMRTTSGRAVLKRRRAKGR 141 Query: 365 XILCTKSNPSSGK 327 +LCTKS PSSGK Sbjct: 142 RVLCTKSYPSSGK 154 >ref|NP_001238013.1| uncharacterized protein LOC100500433 [Glycine max] gi|255630327|gb|ACU15520.1| unknown [Glycine max] Length = 146 Score = 85.5 bits (210), Expect = 2e-14 Identities = 46/73 (63%), Positives = 52/73 (71%) Frame = -1 Query: 545 IGLKREKGRGLVVRAAGKAALCLTKRSRSRKSLARTHGFRRRMRTTSXXXXXXXXXXXXX 366 +G KR KG GLVVRA GKAALCLTKRSRSRKSLARTHGFR+RM T Sbjct: 75 VGTKRGKGSGLVVRA-GKAALCLTKRSRSRKSLARTHGFRKRMSTPGGRAVLRRRRAKGR 133 Query: 365 XILCTKSNPSSGK 327 +LCTK++P+SGK Sbjct: 134 RVLCTKTHPNSGK 146 >ref|NP_001235807.1| uncharacterized protein LOC100526907 [Glycine max] gi|255631125|gb|ACU15928.1| unknown [Glycine max] Length = 146 Score = 83.2 bits (204), Expect = 1e-13 Identities = 45/72 (62%), Positives = 50/72 (69%) Frame = -1 Query: 542 GLKREKGRGLVVRAAGKAALCLTKRSRSRKSLARTHGFRRRMRTTSXXXXXXXXXXXXXX 363 G +R KG GLVVRA GKAALCLTKRSRSRKSLARTHGFR+RM T Sbjct: 76 GTRRGKGSGLVVRA-GKAALCLTKRSRSRKSLARTHGFRKRMSTPGGRAVLRRRRAKGRR 134 Query: 362 ILCTKSNPSSGK 327 LCTK++P+SGK Sbjct: 135 ALCTKTHPNSGK 146 >ref|XP_004485884.1| PREDICTED: 50S ribosomal protein L34, chloroplastic-like [Cicer arietinum] Length = 148 Score = 82.4 bits (202), Expect = 2e-13 Identities = 42/72 (58%), Positives = 51/72 (70%) Frame = -1 Query: 542 GLKREKGRGLVVRAAGKAALCLTKRSRSRKSLARTHGFRRRMRTTSXXXXXXXXXXXXXX 363 G +R GRGLVV AAG++ALCLTKRSRSRKSLARTHGFR+RM T + Sbjct: 77 GARRHNGRGLVVVAAGRSALCLTKRSRSRKSLARTHGFRKRMSTPNGRAILKRRRAKGRK 136 Query: 362 ILCTKSNPSSGK 327 +LCTK++ +SGK Sbjct: 137 VLCTKTHSNSGK 148