BLASTX nr result
ID: Paeonia25_contig00022632
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00022632 (398 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002511355.1| ubiquitin-protein ligase, putative [Ricinus ... 66 6e-09 ref|XP_004253513.1| PREDICTED: putative F-box/LRR-repeat protein... 64 2e-08 emb|CBI32919.3| unnamed protein product [Vitis vinifera] 64 2e-08 ref|NP_191475.1| putative F-box/LRR-repeat protein [Arabidopsis ... 63 4e-08 emb|CAB86943.1| putative protein [Arabidopsis thaliana] 63 4e-08 ref|XP_006366040.1| PREDICTED: putative F-box protein At3g58860-... 63 5e-08 emb|CBI20286.3| unnamed protein product [Vitis vinifera] 63 5e-08 ref|XP_007201620.1| hypothetical protein PRUPE_ppa019914mg, part... 62 6e-08 ref|XP_006583306.1| PREDICTED: putative F-box/LRR-repeat protein... 62 8e-08 ref|XP_007020971.1| Uncharacterized protein TCM_030985 [Theobrom... 62 8e-08 ref|XP_004289225.1| PREDICTED: F-box/LRR-repeat protein At2g4273... 62 8e-08 ref|XP_004244145.1| PREDICTED: putative F-box protein At3g58860-... 62 8e-08 ref|XP_007020038.1| Ubiquitin-protein ligase-like protein isofor... 62 1e-07 ref|XP_007020037.1| Ubiquitin-protein ligase-like protein isofor... 62 1e-07 ref|NP_191476.1| putative F-box/LRR-repeat protein [Arabidopsis ... 62 1e-07 gb|EYU42539.1| hypothetical protein MIMGU_mgv1a008575mg [Mimulus... 61 1e-07 ref|XP_006356871.1| PREDICTED: F-box/FBD/LRR-repeat protein At5g... 61 1e-07 ref|XP_006291049.1| hypothetical protein CARUB_v10017163mg [Caps... 61 1e-07 gb|EYU22245.1| hypothetical protein MIMGU_mgv1a019102mg, partial... 61 2e-07 ref|XP_006441660.1| hypothetical protein CICLE_v10024470mg [Citr... 61 2e-07 >ref|XP_002511355.1| ubiquitin-protein ligase, putative [Ricinus communis] gi|223550470|gb|EEF51957.1| ubiquitin-protein ligase, putative [Ricinus communis] Length = 457 Score = 65.9 bits (159), Expect = 6e-09 Identities = 33/57 (57%), Positives = 42/57 (73%) Frame = +1 Query: 172 SSESIDPKMKEDRISNLSDDLLAFILSFLTVREAAGTSVLARRWRYVWICISSLNFD 342 SS + + KEDRIS+L +++L ILSFLT EA+ TSVL+RRWR +W SSLNFD Sbjct: 8 SSVTSVEEAKEDRISHLPEEILTSILSFLTTEEASRTSVLSRRWRILWTLTSSLNFD 64 >ref|XP_004253513.1| PREDICTED: putative F-box/LRR-repeat protein At3g28410-like, partial [Solanum lycopersicum] Length = 335 Score = 64.3 bits (155), Expect = 2e-08 Identities = 29/47 (61%), Positives = 37/47 (78%) Frame = +1 Query: 202 EDRISNLSDDLLAFILSFLTVREAAGTSVLARRWRYVWICISSLNFD 342 EDRIS L D++L +ILS LTV EA+ TS+L+RRWR +W CI L+FD Sbjct: 26 EDRISQLPDEILVYILSSLTVEEASYTSILSRRWRSLWTCIDRLDFD 72 >emb|CBI32919.3| unnamed protein product [Vitis vinifera] Length = 411 Score = 63.9 bits (154), Expect = 2e-08 Identities = 30/54 (55%), Positives = 39/54 (72%) Frame = +1 Query: 205 DRISNLSDDLLAFILSFLTVREAAGTSVLARRWRYVWICISSLNFDDSGTLTRE 366 DRISNL D +L I+SFL + A GTSVL++RWRY+W I +L+FDD L R+ Sbjct: 10 DRISNLPDAVLCHIISFLPTKFAVGTSVLSKRWRYLWASIPNLDFDDDLLLDRD 63 >ref|NP_191475.1| putative F-box/LRR-repeat protein [Arabidopsis thaliana] gi|75264311|sp|Q9LX55.1|FBL61_ARATH RecName: Full=Putative F-box/LRR-repeat protein At3g59160 gi|7801666|emb|CAB91586.1| putative protein [Arabidopsis thaliana] gi|332646363|gb|AEE79884.1| putative F-box/LRR-repeat protein [Arabidopsis thaliana] Length = 464 Score = 63.2 bits (152), Expect = 4e-08 Identities = 33/74 (44%), Positives = 48/74 (64%) Frame = +1 Query: 166 LISSESIDPKMKEDRISNLSDDLLAFILSFLTVREAAGTSVLARRWRYVWICISSLNFDD 345 ++ S+ +D K D I++L D LL +LS+LT +EAA TS+L+RRWRY+ + +L FDD Sbjct: 1 MVDSKRMDSGSK-DMINDLPDALLCHVLSYLTTKEAASTSLLSRRWRYLLAFVPNLEFDD 59 Query: 346 SGTLTREIRANKVL 387 S L R+ R L Sbjct: 60 SAYLHRDKRVKNPL 73 >emb|CAB86943.1| putative protein [Arabidopsis thaliana] Length = 827 Score = 63.2 bits (152), Expect = 4e-08 Identities = 33/74 (44%), Positives = 48/74 (64%) Frame = +1 Query: 166 LISSESIDPKMKEDRISNLSDDLLAFILSFLTVREAAGTSVLARRWRYVWICISSLNFDD 345 ++ S+ +D K D I++L D LL +LS+LT +EAA TS+L+RRWRY+ + +L FDD Sbjct: 483 MVDSKRMDSGSK-DMINDLPDALLCHVLSYLTTKEAASTSLLSRRWRYLLAFVPNLEFDD 541 Query: 346 SGTLTREIRANKVL 387 S L R+ R L Sbjct: 542 SAYLHRDKRVKNPL 555 >ref|XP_006366040.1| PREDICTED: putative F-box protein At3g58860-like [Solanum tuberosum] Length = 474 Score = 62.8 bits (151), Expect = 5e-08 Identities = 25/54 (46%), Positives = 39/54 (72%) Frame = +1 Query: 187 DPKMKEDRISNLSDDLLAFILSFLTVREAAGTSVLARRWRYVWICISSLNFDDS 348 +P+ ED+ISNL D +L ILS+L R+ GT +L+ RW+ +W C+ +++FDDS Sbjct: 26 NPEGGEDKISNLHDSILLHILSYLPTRDVVGTCILSTRWKNLWTCVENIDFDDS 79 >emb|CBI20286.3| unnamed protein product [Vitis vinifera] Length = 402 Score = 62.8 bits (151), Expect = 5e-08 Identities = 35/71 (49%), Positives = 44/71 (61%) Frame = +1 Query: 130 LNFLFLGVGFCGLISSESIDPKMKEDRISNLSDDLLAFILSFLTVREAAGTSVLARRWRY 309 LNFL++ S D ED +S L D++L ILS LT+REAA TSVL++RWRY Sbjct: 8 LNFLYI-----------SDDGDFGEDLLSELPDEILISILSRLTLREAAATSVLSQRWRY 56 Query: 310 VWICISSLNFD 342 +W S LNFD Sbjct: 57 LWTYTSRLNFD 67 >ref|XP_007201620.1| hypothetical protein PRUPE_ppa019914mg, partial [Prunus persica] gi|462397020|gb|EMJ02819.1| hypothetical protein PRUPE_ppa019914mg, partial [Prunus persica] Length = 323 Score = 62.4 bits (150), Expect = 6e-08 Identities = 29/56 (51%), Positives = 39/56 (69%) Frame = +1 Query: 205 DRISNLSDDLLAFILSFLTVREAAGTSVLARRWRYVWICISSLNFDDSGTLTREIR 372 DRIS L ++L ILS L ++EAA TS+L+R+W+Y+W +LNFDD TL R R Sbjct: 18 DRISYLPHEILVTILSLLPLKEAASTSILSRQWQYLWTSTMNLNFDDEDTLCRTAR 73 >ref|XP_006583306.1| PREDICTED: putative F-box/LRR-repeat protein At5g41630-like [Glycine max] Length = 377 Score = 62.0 bits (149), Expect = 8e-08 Identities = 30/70 (42%), Positives = 46/70 (65%) Frame = +1 Query: 181 SIDPKMKEDRISNLSDDLLAFILSFLTVREAAGTSVLARRWRYVWICISSLNFDDSGTLT 360 +I+ K +DRIS L DD++ ILSFLT++EA TS+L+ RWR++W + SL+ D S + Sbjct: 6 TIESKAGQDRISELPDDVVYHILSFLTIKEAIATSLLSTRWRFLWTMLPSLHIDCSKPIM 65 Query: 361 REIRANKVLL 390 + + V L Sbjct: 66 KLYHSVDVFL 75 >ref|XP_007020971.1| Uncharacterized protein TCM_030985 [Theobroma cacao] gi|508720599|gb|EOY12496.1| Uncharacterized protein TCM_030985 [Theobroma cacao] Length = 816 Score = 62.0 bits (149), Expect = 8e-08 Identities = 32/72 (44%), Positives = 47/72 (65%) Frame = +1 Query: 169 ISSESIDPKMKEDRISNLSDDLLAFILSFLTVREAAGTSVLARRWRYVWICISSLNFDDS 348 +S E D EDRIS+L DD+L ILSF+ +EA TSVL+ RW+ +WI + +L F+D Sbjct: 468 MSLERQDAGQGEDRISSLPDDVLVHILSFIPTKEAVRTSVLSTRWKNLWISLPNLTFEDP 527 Query: 349 GTLTREIRANKV 384 + +IRA+ + Sbjct: 528 DPI-EDIRASSL 538 Score = 57.4 bits (137), Expect = 2e-06 Identities = 28/59 (47%), Positives = 39/59 (66%) Frame = +1 Query: 169 ISSESIDPKMKEDRISNLSDDLLAFILSFLTVREAAGTSVLARRWRYVWICISSLNFDD 345 +S E+ D EDRISNL +D+L LSFL +EA TSVL+ RW+ +W+ + +L F D Sbjct: 22 MSLETQDANKGEDRISNLPEDVLVHSLSFLPTKEAIRTSVLSTRWQTLWMSLPNLTFTD 80 >ref|XP_004289225.1| PREDICTED: F-box/LRR-repeat protein At2g42730-like [Fragaria vesca subsp. vesca] Length = 463 Score = 62.0 bits (149), Expect = 8e-08 Identities = 29/54 (53%), Positives = 38/54 (70%) Frame = +1 Query: 202 EDRISNLSDDLLAFILSFLTVREAAGTSVLARRWRYVWICISSLNFDDSGTLTR 363 EDRIS L D++L ILS L+++EA TS+L+RRW YVW ++LNFD L R Sbjct: 25 EDRISGLPDEILVSILSLLSLKEAQATSILSRRWHYVWAFSTTLNFDAEQRLIR 78 >ref|XP_004244145.1| PREDICTED: putative F-box protein At3g58860-like [Solanum lycopersicum] Length = 474 Score = 62.0 bits (149), Expect = 8e-08 Identities = 25/54 (46%), Positives = 38/54 (70%) Frame = +1 Query: 187 DPKMKEDRISNLSDDLLAFILSFLTVREAAGTSVLARRWRYVWICISSLNFDDS 348 +P+ ED ISNL D +L ILS+L R+ GT +L+ RW+ +W C+ +++FDDS Sbjct: 26 NPEGGEDEISNLPDSILLHILSYLPTRDVVGTCILSTRWKNLWTCVENIDFDDS 79 >ref|XP_007020038.1| Ubiquitin-protein ligase-like protein isoform 2 [Theobroma cacao] gi|508725366|gb|EOY17263.1| Ubiquitin-protein ligase-like protein isoform 2 [Theobroma cacao] Length = 459 Score = 61.6 bits (148), Expect = 1e-07 Identities = 28/58 (48%), Positives = 43/58 (74%), Gaps = 3/58 (5%) Frame = +1 Query: 178 ESIDPKMK---EDRISNLSDDLLAFILSFLTVREAAGTSVLARRWRYVWICISSLNFD 342 ++++PK +DRIS L D++L ILSFL++R AA + +L+RRWR++W + SLNFD Sbjct: 2 QTVNPKRSNTMKDRISELPDEILVHILSFLSLRNAARSGILSRRWRHLWKSVPSLNFD 59 >ref|XP_007020037.1| Ubiquitin-protein ligase-like protein isoform 1 [Theobroma cacao] gi|508725365|gb|EOY17262.1| Ubiquitin-protein ligase-like protein isoform 1 [Theobroma cacao] Length = 544 Score = 61.6 bits (148), Expect = 1e-07 Identities = 28/58 (48%), Positives = 43/58 (74%), Gaps = 3/58 (5%) Frame = +1 Query: 178 ESIDPKMK---EDRISNLSDDLLAFILSFLTVREAAGTSVLARRWRYVWICISSLNFD 342 ++++PK +DRIS L D++L ILSFL++R AA + +L+RRWR++W + SLNFD Sbjct: 2 QTVNPKRSNTMKDRISELPDEILVHILSFLSLRNAARSGILSRRWRHLWKSVPSLNFD 59 >ref|NP_191476.1| putative F-box/LRR-repeat protein [Arabidopsis thaliana] gi|75264310|sp|Q9LX54.1|FBL62_ARATH RecName: Full=Putative F-box/LRR-repeat protein At3g59170 gi|7801667|emb|CAB91587.1| putative protein [Arabidopsis thaliana] gi|332646364|gb|AEE79885.1| putative F-box/LRR-repeat protein [Arabidopsis thaliana] Length = 473 Score = 61.6 bits (148), Expect = 1e-07 Identities = 32/64 (50%), Positives = 42/64 (65%) Frame = +1 Query: 196 MKEDRISNLSDDLLAFILSFLTVREAAGTSVLARRWRYVWICISSLNFDDSGTLTREIRA 375 + +D I+ L D LL ILSFLT +EAA TS+L+RRWRY+ + +L FDDS L R+ R Sbjct: 4 VSKDMINVLPDALLCHILSFLTTKEAASTSLLSRRWRYLLAFVPNLEFDDSVYLHRDKRV 63 Query: 376 NKVL 387 L Sbjct: 64 KNTL 67 >gb|EYU42539.1| hypothetical protein MIMGU_mgv1a008575mg [Mimulus guttatus] Length = 369 Score = 61.2 bits (147), Expect = 1e-07 Identities = 30/58 (51%), Positives = 39/58 (67%) Frame = +1 Query: 184 IDPKMKEDRISNLSDDLLAFILSFLTVREAAGTSVLARRWRYVWICISSLNFDDSGTL 357 ++ K +D I+ L D+LL I+S L V+EA TSV+ARRWRY W C S L+FD S L Sbjct: 16 VNSKCTQDSINRLPDELLISIVSHLPVKEAIKTSVIARRWRYFWKCSSILDFDGSKVL 73 >ref|XP_006356871.1| PREDICTED: F-box/FBD/LRR-repeat protein At5g53840-like [Solanum tuberosum] Length = 476 Score = 61.2 bits (147), Expect = 1e-07 Identities = 28/48 (58%), Positives = 37/48 (77%) Frame = +1 Query: 199 KEDRISNLSDDLLAFILSFLTVREAAGTSVLARRWRYVWICISSLNFD 342 +EDRIS L D++L +ILSF TV+EAA TS+L+RRW +W I L+FD Sbjct: 24 QEDRISQLPDEILVYILSFFTVKEAADTSLLSRRWLNLWTYIDHLDFD 71 >ref|XP_006291049.1| hypothetical protein CARUB_v10017163mg [Capsella rubella] gi|482559756|gb|EOA23947.1| hypothetical protein CARUB_v10017163mg [Capsella rubella] Length = 472 Score = 61.2 bits (147), Expect = 1e-07 Identities = 31/64 (48%), Positives = 41/64 (64%) Frame = +1 Query: 196 MKEDRISNLSDDLLAFILSFLTVREAAGTSVLARRWRYVWICISSLNFDDSGTLTREIRA 375 + +D IS+L D LL +LSFLT +EAA TS+L+RRWRY+ + L FDDS L + R Sbjct: 4 VSKDLISDLPDSLLCHVLSFLTTKEAASTSILSRRWRYLLAFVPKLEFDDSVFLHPDKRV 63 Query: 376 NKVL 387 L Sbjct: 64 KNPL 67 >gb|EYU22245.1| hypothetical protein MIMGU_mgv1a019102mg, partial [Mimulus guttatus] Length = 307 Score = 60.8 bits (146), Expect = 2e-07 Identities = 30/68 (44%), Positives = 40/68 (58%) Frame = +1 Query: 160 CGLISSESIDPKMKEDRISNLSDDLLAFILSFLTVREAAGTSVLARRWRYVWICISSLNF 339 C ++ +D DRI L DDLL ILS LT +EA TSVL+ RWRY+W + L+F Sbjct: 9 CSEKDNKGLDKHSSIDRIGALPDDLLVNILSLLTFKEAIATSVLSSRWRYLWTFVPKLDF 68 Query: 340 DDSGTLTR 363 D +L + Sbjct: 69 DGGESLLK 76 >ref|XP_006441660.1| hypothetical protein CICLE_v10024470mg [Citrus clementina] gi|557543922|gb|ESR54900.1| hypothetical protein CICLE_v10024470mg [Citrus clementina] Length = 337 Score = 60.8 bits (146), Expect = 2e-07 Identities = 28/55 (50%), Positives = 39/55 (70%) Frame = +1 Query: 193 KMKEDRISNLSDDLLAFILSFLTVREAAGTSVLARRWRYVWICISSLNFDDSGTL 357 K+ EDRIS L D +L+ IL+FL + +A TS L+RRWR+VW + +L FDD G + Sbjct: 19 KVPEDRISALPDSVLSNILTFLPLEDAVATSSLSRRWRHVWTSVRNLCFDDGGPM 73