BLASTX nr result
ID: Paeonia25_contig00022530
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00022530 (388 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007201819.1| hypothetical protein PRUPE_ppa008841mg [Prun... 57 3e-06 >ref|XP_007201819.1| hypothetical protein PRUPE_ppa008841mg [Prunus persica] gi|462397219|gb|EMJ03018.1| hypothetical protein PRUPE_ppa008841mg [Prunus persica] Length = 317 Score = 57.0 bits (136), Expect = 3e-06 Identities = 26/31 (83%), Positives = 29/31 (93%) Frame = +3 Query: 3 VSESCEVALTMLEFERSGKTFAYYFMQAPPV 95 VS+SCEVAL+MLEFERSGK+F Y FMQAPPV Sbjct: 286 VSQSCEVALSMLEFERSGKSFEYLFMQAPPV 316