BLASTX nr result
ID: Paeonia25_contig00022215
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00022215 (584 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXB66844.1| hypothetical protein L484_019481 [Morus notabilis] 65 1e-08 >gb|EXB66844.1| hypothetical protein L484_019481 [Morus notabilis] Length = 145 Score = 65.5 bits (158), Expect = 1e-08 Identities = 35/58 (60%), Positives = 42/58 (72%), Gaps = 2/58 (3%) Frame = +1 Query: 268 LLMYMVIVEEEDWLVNVPDSNLGVL--RLLYLSFEQKASSLCFPRDRWDREFFQLQGG 435 L MY+VI+EEE+ LVNV DS+LGVL R+ EQKA + PR RWD+EFF LQGG Sbjct: 88 LWMYLVIIEEENRLVNVADSSLGVLSPRIRLSFLEQKAFAFGVPRARWDKEFFALQGG 145