BLASTX nr result
ID: Paeonia25_contig00022127
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00022127 (287 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AFK39190.1| unknown [Medicago truncatula] 58 1e-06 ref|XP_003637700.1| Dual-specificity protein phosphatase-like pr... 57 2e-06 ref|XP_006378145.1| hypothetical protein POPTR_0010s03980g [Popu... 56 4e-06 >gb|AFK39190.1| unknown [Medicago truncatula] Length = 183 Score = 58.2 bits (139), Expect = 1e-06 Identities = 25/38 (65%), Positives = 32/38 (84%) Frame = +2 Query: 8 GMNLDQALRHVRCKRPQANPNPGFILQLKDFEQSLNKV 121 GM+L +AL+HV+CKRPQA PN GFI QL+DFE+SL + Sbjct: 142 GMSLSEALQHVKCKRPQATPNRGFIRQLEDFEKSLQDI 179 >ref|XP_003637700.1| Dual-specificity protein phosphatase-like protein, partial [Medicago truncatula] gi|355503635|gb|AES84838.1| Dual-specificity protein phosphatase-like protein, partial [Medicago truncatula] Length = 87 Score = 57.4 bits (137), Expect = 2e-06 Identities = 25/35 (71%), Positives = 31/35 (88%) Frame = +2 Query: 8 GMNLDQALRHVRCKRPQANPNPGFILQLKDFEQSL 112 GM+L +AL+HV+CKRPQA PN GFI QL+DFE+SL Sbjct: 51 GMSLSEALQHVKCKRPQATPNRGFIRQLEDFEKSL 85 >ref|XP_006378145.1| hypothetical protein POPTR_0010s03980g [Populus trichocarpa] gi|550329015|gb|ERP55942.1| hypothetical protein POPTR_0010s03980g [Populus trichocarpa] Length = 175 Score = 56.2 bits (134), Expect = 4e-06 Identities = 25/41 (60%), Positives = 32/41 (78%) Frame = +2 Query: 2 RYGMNLDQALRHVRCKRPQANPNPGFILQLKDFEQSLNKVT 124 R+GM L +AL HV+ KRPQA PN GFI QL+DFE+SL ++ Sbjct: 134 RHGMRLSEALAHVKSKRPQAGPNSGFISQLQDFEKSLQGIS 174