BLASTX nr result
ID: Paeonia25_contig00020450
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00020450 (362 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EIW63890.1| protein kinase subdomain-containing protein PKL [... 70 4e-10 ref|XP_001830919.2| protein kinase subdomain-containing protein ... 64 2e-08 >gb|EIW63890.1| protein kinase subdomain-containing protein PKL [Trametes versicolor FP-101664 SS1] Length = 291 Score = 69.7 bits (169), Expect = 4e-10 Identities = 35/72 (48%), Positives = 43/72 (59%), Gaps = 3/72 (4%) Frame = -1 Query: 362 GLEEWRKKRSRICLIDWQNAGWFPLEWEAVKAT---TIYGRNGWFELMLEVFPESRAEME 192 GLE+WR LIDW+ AGW PL WEA+KAT T + W+ LM EVF E E+E Sbjct: 218 GLEKWRAGSESAVLIDWEYAGWMPLPWEALKATWLITERDEDEWYTLMKEVFVEEELELE 277 Query: 191 GEDEWRLRSRTV 156 + WR +SR V Sbjct: 278 TDWLWRSQSRIV 289 >ref|XP_001830919.2| protein kinase subdomain-containing protein PKL [Coprinopsis cinerea okayama7#130] gi|298409827|gb|EAU90983.2| protein kinase subdomain-containing protein PKL [Coprinopsis cinerea okayama7#130] Length = 288 Score = 64.3 bits (155), Expect = 2e-08 Identities = 27/73 (36%), Positives = 44/73 (60%), Gaps = 2/73 (2%) Frame = -1 Query: 362 GLEEWRKKRSRICLIDWQNAGWFPLEWEAVKATTIYGR--NGWFELMLEVFPESRAEMEG 189 GL WR+ +SR+CL+DW+ +GW P WEA+KAT + + W + + PE + ++ Sbjct: 216 GLSAWRRGKSRLCLVDWEYSGWMPAPWEALKATLMECEEDSEWLVTIRKALPEFKEYLDA 275 Query: 188 EDEWRLRSRTVPV 150 + EWR +S + V Sbjct: 276 DWEWRSKSNMMIV 288