BLASTX nr result
ID: Paeonia25_contig00017490
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00017490 (2002 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMD35680.1| hypothetical protein CERSUDRAFT_85643 [Ceriporiop... 64 2e-07 emb|CCM02166.1| predicted protein [Fibroporia radiculosa] 63 6e-07 >gb|EMD35680.1| hypothetical protein CERSUDRAFT_85643 [Ceriporiopsis subvermispora B] Length = 569 Score = 64.3 bits (155), Expect = 2e-07 Identities = 36/73 (49%), Positives = 47/73 (64%) Frame = -2 Query: 219 KDRNDEYHQKLLKQGSASANPAANGTDVAAGSIGGNNFVKGADYLLIDRPFFVTIGKDGL 40 KD + + H L++ SA+ P+ VA G+ F++ DY L +RPFFV IGKDGL Sbjct: 23 KDLSLDQHDDYLRKPSANGKPSHGLQPVAEGT-----FLRTEDYTLGNRPFFVNIGKDGL 77 Query: 39 IAALQKLDRQLRN 1 IAALQKLD QL+N Sbjct: 78 IAALQKLDTQLKN 90 >emb|CCM02166.1| predicted protein [Fibroporia radiculosa] Length = 682 Score = 62.8 bits (151), Expect = 6e-07 Identities = 27/42 (64%), Positives = 37/42 (88%) Frame = -2 Query: 126 SIGGNNFVKGADYLLIDRPFFVTIGKDGLIAALQKLDRQLRN 1 ++ G++F + ADY ++DRPFF++IGKDGLIAALQKLD QL+N Sbjct: 162 TLNGSSFGRTADYTVVDRPFFISIGKDGLIAALQKLDTQLKN 203