BLASTX nr result
ID: Paeonia25_contig00017394
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00017394 (397 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI17145.3| unnamed protein product [Vitis vinifera] 59 7e-07 ref|XP_006488013.1| PREDICTED: uncharacterized protein LOC102629... 59 9e-07 ref|XP_006488012.1| PREDICTED: uncharacterized protein LOC102629... 59 9e-07 ref|XP_006424461.1| hypothetical protein CICLE_v10028403mg [Citr... 59 9e-07 ref|XP_002523713.1| conserved hypothetical protein [Ricinus comm... 58 1e-06 ref|XP_002273011.1| PREDICTED: uncharacterized protein LOC100265... 56 6e-06 >emb|CBI17145.3| unnamed protein product [Vitis vinifera] Length = 458 Score = 58.9 bits (141), Expect = 7e-07 Identities = 32/65 (49%), Positives = 42/65 (64%), Gaps = 3/65 (4%) Frame = +3 Query: 96 IMDMDAPLDFELHDPLCSTRVRTAGRSD--SMENLWADHLKQKSELIEREAKRAKMEIC- 266 ++DMD PLDFE DPL S+ R +++L D+ K+KS L+ERE+KRAK C Sbjct: 1 MIDMDGPLDFESEDPLLSSSTPKKKRRKVIGLDDLLTDYYKEKSRLVERESKRAKASKCY 60 Query: 267 NSDED 281 NSDED Sbjct: 61 NSDED 65 >ref|XP_006488013.1| PREDICTED: uncharacterized protein LOC102629715 isoform X2 [Citrus sinensis] Length = 457 Score = 58.5 bits (140), Expect = 9e-07 Identities = 33/69 (47%), Positives = 44/69 (63%), Gaps = 4/69 (5%) Frame = +3 Query: 99 MDMDAPLDFELHDPLCSTRVRTAGRSDS--MENLWADHLKQKSELIEREAKRA--KMEIC 266 MD+D PLDFE DPL + V R + +++L DH KQKS+++ERE KRA + Sbjct: 1 MDLDDPLDFENEDPLLTNPVVNKKRKKAIGLDDLLTDHYKQKSQILEREKKRAAKAKKNY 60 Query: 267 NSDEDHHGK 293 NSDED +GK Sbjct: 61 NSDEDENGK 69 >ref|XP_006488012.1| PREDICTED: uncharacterized protein LOC102629715 isoform X1 [Citrus sinensis] Length = 470 Score = 58.5 bits (140), Expect = 9e-07 Identities = 33/69 (47%), Positives = 44/69 (63%), Gaps = 4/69 (5%) Frame = +3 Query: 99 MDMDAPLDFELHDPLCSTRVRTAGRSDS--MENLWADHLKQKSELIEREAKRA--KMEIC 266 MD+D PLDFE DPL + V R + +++L DH KQKS+++ERE KRA + Sbjct: 1 MDLDDPLDFENEDPLLTNPVVNKKRKKAIGLDDLLTDHYKQKSQILEREKKRAAKAKKNY 60 Query: 267 NSDEDHHGK 293 NSDED +GK Sbjct: 61 NSDEDENGK 69 >ref|XP_006424461.1| hypothetical protein CICLE_v10028403mg [Citrus clementina] gi|557526395|gb|ESR37701.1| hypothetical protein CICLE_v10028403mg [Citrus clementina] Length = 457 Score = 58.5 bits (140), Expect = 9e-07 Identities = 33/69 (47%), Positives = 44/69 (63%), Gaps = 4/69 (5%) Frame = +3 Query: 99 MDMDAPLDFELHDPLCSTRVRTAGRSDS--MENLWADHLKQKSELIEREAKRA--KMEIC 266 MD+D PLDFE DPL + V R + +++L DH KQKS+++ERE KRA + Sbjct: 1 MDLDDPLDFENEDPLITNPVVNKKRKKAIGLDDLLTDHYKQKSQILEREKKRAAKAKKNY 60 Query: 267 NSDEDHHGK 293 NSDED +GK Sbjct: 61 NSDEDENGK 69 >ref|XP_002523713.1| conserved hypothetical protein [Ricinus communis] gi|223537017|gb|EEF38653.1| conserved hypothetical protein [Ricinus communis] Length = 458 Score = 58.2 bits (139), Expect = 1e-06 Identities = 33/69 (47%), Positives = 46/69 (66%), Gaps = 3/69 (4%) Frame = +3 Query: 96 IMDMDAPLDFELHDPLCSTRVRTAGRSD--SMENLWADHLKQKSELIEREAKRAK-MEIC 266 ++++D PLDFE DPL ST T R +++L D+ K+KS++IERE+KRAK + Sbjct: 1 MLNIDDPLDFESEDPLASTPAITQKRKKVIGLDDLLTDYYKEKSKVIERESKRAKSRKYY 60 Query: 267 NSDEDHHGK 293 NSDED GK Sbjct: 61 NSDEDDCGK 69 >ref|XP_002273011.1| PREDICTED: uncharacterized protein LOC100265349 [Vitis vinifera] Length = 455 Score = 55.8 bits (133), Expect = 6e-06 Identities = 31/62 (50%), Positives = 39/62 (62%), Gaps = 3/62 (4%) Frame = +3 Query: 105 MDAPLDFELHDPLCSTRVRTAGRSD--SMENLWADHLKQKSELIEREAKRAKMEIC-NSD 275 MD PLDFE DPL S+ R +++L D+ K+KS L+ERE+KRAK C NSD Sbjct: 1 MDGPLDFESEDPLLSSSTPKKKRRKVIGLDDLLTDYYKEKSRLVERESKRAKASKCYNSD 60 Query: 276 ED 281 ED Sbjct: 61 ED 62