BLASTX nr result
ID: Paeonia25_contig00017067
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00017067 (2451 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMD36597.1| hypothetical protein CERSUDRAFT_84779 [Ceriporiop... 106 4e-20 gb|ESK94515.1| hypothetical protein Moror_7982 [Moniliophthora r... 82 9e-13 gb|EUC67605.1| F-box-like domain protein, putative [Rhizoctonia ... 79 1e-11 ref|XP_007306927.1| hypothetical protein STEHIDRAFT_132910 [Ster... 78 2e-11 ref|XP_007397970.1| hypothetical protein PHACADRAFT_259513 [Phan... 76 8e-11 gb|ELU39730.1| F-box-like domain-containing protein [Rhizoctonia... 75 1e-10 emb|CCM01783.1| predicted protein [Fibroporia radiculosa] 74 3e-10 ref|XP_001888896.1| predicted protein [Laccaria bicolor S238N-H8... 74 3e-10 gb|ESK93371.1| hypothetical protein Moror_1782 [Moniliophthora r... 69 1e-08 emb|CCA71970.1| hypothetical protein PIIN_05905 [Piriformospora ... 65 1e-07 ref|XP_007333937.1| hypothetical protein AGABI1DRAFT_116394 [Aga... 60 4e-06 ref|XP_006456269.1| hypothetical protein AGABI2DRAFT_195461 [Aga... 60 5e-06 >gb|EMD36597.1| hypothetical protein CERSUDRAFT_84779 [Ceriporiopsis subvermispora B] Length = 1030 Score = 106 bits (265), Expect = 4e-20 Identities = 57/144 (39%), Positives = 82/144 (56%), Gaps = 2/144 (1%) Frame = +3 Query: 2022 RRED-EPSPRAIKAIXXXXXXXXXXXDEYXXXXXXXXXXXXXXXXQQIAAEIEASLSGLP 2198 R ED + +PR I+A+ +EY + +A E E+ S Sbjct: 493 RAEDVDDTPRIIQAVPPVQPPTPISPEEYVCARSQRRSARPEKTARPVAMEPESLGSESE 552 Query: 2199 ASE-PREPTFYPLGKHLIQPALLGALLPYLSIQEWCAVSSVDRETRRALFEERALSEIAL 2375 + +EPT+YPL +H+ P LL LLPYLS +W +VS+V +E RR L +R L E+ L Sbjct: 553 EVQVEKEPTWYPLARHMTDPELLAGLLPYLSFYDWSSVSAVSKEIRRKLSGDRVLCEMVL 612 Query: 2376 ERDLKTIGYSRWSWPEPEPLALTL 2447 ER L+T+GY+RW+WPEP+PL L+L Sbjct: 613 ERYLRTVGYARWAWPEPDPLTLSL 636 >gb|ESK94515.1| hypothetical protein Moror_7982 [Moniliophthora roreri MCA 2997] Length = 1208 Score = 82.4 bits (202), Expect = 9e-13 Identities = 40/88 (45%), Positives = 52/88 (59%) Frame = +3 Query: 2184 LSGLPASEPREPTFYPLGKHLIQPALLGALLPYLSIQEWCAVSSVDRETRRALFEERALS 2363 + G+ + R +PL L P LL +L+ YLS EWC +SS+ + R L R L Sbjct: 718 VQGITVRQDRPAEPFPLASFLEDPILLSSLITYLSYYEWCNLSSISKSIRTLLTSTRLLK 777 Query: 2364 EIALERDLKTIGYSRWSWPEPEPLALTL 2447 E LER L T+GYSRW WPE EPL+L+L Sbjct: 778 EEILERYLHTVGYSRWVWPEREPLSLSL 805 >gb|EUC67605.1| F-box-like domain protein, putative [Rhizoctonia solani AG-3 Rhs1AP] Length = 666 Score = 79.0 bits (193), Expect = 1e-11 Identities = 39/84 (46%), Positives = 53/84 (63%) Frame = +3 Query: 2196 PASEPREPTFYPLGKHLIQPALLGALLPYLSIQEWCAVSSVDRETRRALFEERALSEIAL 2375 P P P YPL HL P+LL ALLP+LS ++W A+++++ RR L E RAL E L Sbjct: 258 PPGSPPPPKIYPLETHLNMPSLLAALLPHLSFRDWNALNALNAGARRQLEETRALREEVL 317 Query: 2376 ERDLKTIGYSRWSWPEPEPLALTL 2447 E L +GY+RW + EP++LTL Sbjct: 318 EHWLHAVGYARWKAHKREPISLTL 341 >ref|XP_007306927.1| hypothetical protein STEHIDRAFT_132910 [Stereum hirsutum FP-91666 SS1] gi|389742586|gb|EIM83772.1| hypothetical protein STEHIDRAFT_132910 [Stereum hirsutum FP-91666 SS1] Length = 867 Score = 77.8 bits (190), Expect = 2e-11 Identities = 42/78 (53%), Positives = 50/78 (64%), Gaps = 2/78 (2%) Frame = +3 Query: 2220 TFYPLGKHLIQPALLGALLPYLSIQEWCAVSSVDRETRRALFEERALSEIALERDLKTIG 2399 ++YPL KHL +PALL ALL LS EW A+ S+ +E R E R L E+ALER L +G Sbjct: 365 SWYPLVKHLSEPALLAALLNELSFPEWMALWSLTKEVRTMFEEVRELREVALERYLGIVG 424 Query: 2400 YSRWSWP--EPEPLALTL 2447 Y RW W PEPL LTL Sbjct: 425 YVRWRWEPHTPEPLRLTL 442 >ref|XP_007397970.1| hypothetical protein PHACADRAFT_259513 [Phanerochaete carnosa HHB-10118-sp] gi|409043796|gb|EKM53278.1| hypothetical protein PHACADRAFT_259513 [Phanerochaete carnosa HHB-10118-sp] Length = 551 Score = 75.9 bits (185), Expect = 8e-11 Identities = 41/93 (44%), Positives = 56/93 (60%), Gaps = 1/93 (1%) Frame = +3 Query: 2172 IEASLSGLPASE-PREPTFYPLGKHLIQPALLGALLPYLSIQEWCAVSSVDRETRRALFE 2348 +E + P SE P + YPL HL P LL LL YLS EW +++V +E R L+E Sbjct: 73 VEDQTTTRPHSEAPEDLAPYPLVAHLSDPVLLENLLTYLSYYEWLRLATVSKEIRHTLYE 132 Query: 2349 ERALSEIALERDLKTIGYSRWSWPEPEPLALTL 2447 + E L R L+T+GYS+W+W +PEPL LT+ Sbjct: 133 DG--REQVLARYLQTVGYSKWTWNDPEPLILTV 163 >gb|ELU39730.1| F-box-like domain-containing protein [Rhizoctonia solani AG-1 IA] Length = 1116 Score = 75.5 bits (184), Expect = 1e-10 Identities = 37/84 (44%), Positives = 53/84 (63%) Frame = +3 Query: 2196 PASEPREPTFYPLGKHLIQPALLGALLPYLSIQEWCAVSSVDRETRRALFEERALSEIAL 2375 P P P YPL HL P+L+ ALLP+LS ++W A+++++ RR L + RAL E L Sbjct: 219 PPGSPPPPKIYPLETHLNMPSLIAALLPHLSFRDWNALNALNAGIRRQLEDTRALREEVL 278 Query: 2376 ERDLKTIGYSRWSWPEPEPLALTL 2447 E L+ +GY+RW + EP+ LTL Sbjct: 279 EYWLRGVGYARWKSHKREPVGLTL 302 >emb|CCM01783.1| predicted protein [Fibroporia radiculosa] Length = 1747 Score = 73.9 bits (180), Expect = 3e-10 Identities = 38/85 (44%), Positives = 49/85 (57%) Frame = +3 Query: 2175 EASLSGLPASEPREPTFYPLGKHLIQPALLGALLPYLSIQEWCAVSSVDRETRRALFEER 2354 +AS+ +P P+ YP +HL+ P LL LL +L+ EWCAVS V + R + ER Sbjct: 1238 DASIEMIP---PKPSGPYPFVRHLMTPPLLAGLLAHLTFAEWCAVSRVSKAARETVDRER 1294 Query: 2355 ALSEIALERDLKTIGYSRWSWPEPE 2429 L E LER L T+GY RW W E E Sbjct: 1295 ELRECVLERFLCTVGYVRWIWGEKE 1319 >ref|XP_001888896.1| predicted protein [Laccaria bicolor S238N-H82] gi|164636206|gb|EDR00504.1| predicted protein [Laccaria bicolor S238N-H82] Length = 1539 Score = 73.9 bits (180), Expect = 3e-10 Identities = 38/94 (40%), Positives = 53/94 (56%) Frame = +3 Query: 2166 AEIEASLSGLPASEPREPTFYPLGKHLIQPALLGALLPYLSIQEWCAVSSVDRETRRALF 2345 A +A+L A EP ++ L + L ++ LL Y + EWC +SS+ +E R L Sbjct: 913 AGTDATLEHEEAEEPVSSYYFNLAELLSHHQVVRNLLEYTNFYEWCILSSISKEIRILLV 972 Query: 2346 EERALSEIALERDLKTIGYSRWSWPEPEPLALTL 2447 + L E LER LKT+GY RW W PEPL+L+L Sbjct: 973 QSPPLREEVLERFLKTVGYGRWGWDGPEPLSLSL 1006 >gb|ESK93371.1| hypothetical protein Moror_1782 [Moniliophthora roreri MCA 2997] Length = 783 Score = 68.6 bits (166), Expect = 1e-08 Identities = 36/92 (39%), Positives = 51/92 (55%) Frame = +3 Query: 2175 EASLSGLPASEPREPTFYPLGKHLIQPALLGALLPYLSIQEWCAVSSVDRETRRALFEER 2354 E ++S P PR + L L P+ L LL LS +WC++ +V +E + L + Sbjct: 312 ETAISAEPEPSPRPS--HTLALFLSDPSRLSGLLQNLSFADWCSLFNVSKEIQMMLIQNE 369 Query: 2355 ALSEIALERDLKTIGYSRWSWPEPEPLALTLS 2450 L E LER LK +GYSRW+W E E + L+LS Sbjct: 370 LLKEEVLERYLKDVGYSRWTWRESETMNLSLS 401 >emb|CCA71970.1| hypothetical protein PIIN_05905 [Piriformospora indica DSM 11827] Length = 1206 Score = 65.5 bits (158), Expect = 1e-07 Identities = 35/80 (43%), Positives = 46/80 (57%), Gaps = 1/80 (1%) Frame = +3 Query: 2205 EPREPTFYPLGKHLIQPALLGALLPYLSIQEWCAVSSVDRETRRALFEERALSEIALERD 2384 EP E FYP+ HL P LL A LPYL + ++SS + R L + R L E LER Sbjct: 784 EPEEEKFYPIEMHLSYPVLLAATLPYLQFPDTLSLSSSSKVIRNMLEDRRELREEILERY 843 Query: 2385 LKTIGYSRWSW-PEPEPLAL 2441 L T+GY+RW + + EP+ L Sbjct: 844 LGTVGYTRWDFGKKKEPMDL 863 >ref|XP_007333937.1| hypothetical protein AGABI1DRAFT_116394 [Agaricus bisporus var. burnettii JB137-S8] gi|409075091|gb|EKM75476.1| hypothetical protein AGABI1DRAFT_116394 [Agaricus bisporus var. burnettii JB137-S8] Length = 475 Score = 60.5 bits (145), Expect = 4e-06 Identities = 31/69 (44%), Positives = 42/69 (60%), Gaps = 1/69 (1%) Frame = +3 Query: 2244 LIQPALLGALLPYLSIQEWCAVSSVDRETRRALFEERALSEIALERDLKTIGYSRWSWPE 2423 + P L LL YL+ EW ++SV R R + ++R L E LER L+ +GY RWSW E Sbjct: 6 IADPEFLQMLLEYLNFFEWSLLASVSRTIRIVMVQKRELREEILERFLRPVGYQRWSWEE 65 Query: 2424 -PEPLALTL 2447 PE L+L+L Sbjct: 66 SPEALSLSL 74 >ref|XP_006456269.1| hypothetical protein AGABI2DRAFT_195461 [Agaricus bisporus var. bisporus H97] gi|426193343|gb|EKV43277.1| hypothetical protein AGABI2DRAFT_195461 [Agaricus bisporus var. bisporus H97] Length = 473 Score = 60.1 bits (144), Expect = 5e-06 Identities = 31/69 (44%), Positives = 42/69 (60%), Gaps = 1/69 (1%) Frame = +3 Query: 2244 LIQPALLGALLPYLSIQEWCAVSSVDRETRRALFEERALSEIALERDLKTIGYSRWSWPE 2423 + P L LL YL+ EW ++SV R R + ++R L E LER L+ +GY RWSW E Sbjct: 6 IADPEFLQMLLEYLNFFEWSLLASVSRTIRIVMVQKRDLREEILERFLRPVGYQRWSWEE 65 Query: 2424 -PEPLALTL 2447 PE L+L+L Sbjct: 66 SPEALSLSL 74