BLASTX nr result
ID: Paeonia25_contig00017047
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00017047 (208 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002305244.2| hypothetical protein POPTR_0004s07750g [Popu... 62 6e-08 ref|XP_002273113.2| PREDICTED: uncharacterized membrane protein ... 60 3e-07 ref|XP_006422011.1| hypothetical protein CICLE_v10004922mg [Citr... 59 7e-07 ref|XP_002513660.1| conserved hypothetical protein [Ricinus comm... 59 7e-07 ref|XP_006829036.1| hypothetical protein AMTR_s00001p00253690 [A... 57 3e-06 ref|XP_007038793.1| Keratin-associated protein 5-4 [Theobroma ca... 56 5e-06 >ref|XP_002305244.2| hypothetical protein POPTR_0004s07750g [Populus trichocarpa] gi|550340557|gb|EEE85755.2| hypothetical protein POPTR_0004s07750g [Populus trichocarpa] Length = 452 Score = 62.4 bits (150), Expect = 6e-08 Identities = 34/57 (59%), Positives = 36/57 (63%) Frame = +2 Query: 2 VGLATSNLGIISCEAPAYSXXXXXXXXXXXXXXXYRVDLGHVIQPIGTLLLAFLLGS 172 VGLA SNLGIISCE+PAYS +R DL VIQ GTLLLAFLLGS Sbjct: 116 VGLAASNLGIISCESPAYSIVLKFLLPLAVPLLLFRADLRRVIQSTGTLLLAFLLGS 172 >ref|XP_002273113.2| PREDICTED: uncharacterized membrane protein yjcL-like [Vitis vinifera] gi|302143806|emb|CBI22667.3| unnamed protein product [Vitis vinifera] Length = 449 Score = 60.1 bits (144), Expect = 3e-07 Identities = 32/57 (56%), Positives = 35/57 (61%) Frame = +2 Query: 2 VGLATSNLGIISCEAPAYSXXXXXXXXXXXXXXXYRVDLGHVIQPIGTLLLAFLLGS 172 VGLA SNLGIISCEAPAYS +R DL VIQ G LL+AFL+GS Sbjct: 116 VGLAASNLGIISCEAPAYSVVLNFLLPLAVPLLLFRADLRRVIQSTGALLMAFLIGS 172 >ref|XP_006422011.1| hypothetical protein CICLE_v10004922mg [Citrus clementina] gi|568875109|ref|XP_006490652.1| PREDICTED: uncharacterized protein LOC102608862 [Citrus sinensis] gi|557523884|gb|ESR35251.1| hypothetical protein CICLE_v10004922mg [Citrus clementina] Length = 466 Score = 58.9 bits (141), Expect = 7e-07 Identities = 29/57 (50%), Positives = 36/57 (63%) Frame = +2 Query: 2 VGLATSNLGIISCEAPAYSXXXXXXXXXXXXXXXYRVDLGHVIQPIGTLLLAFLLGS 172 +GLA SNLG++SCE+PAYS +R DL VI+ GTLLLAFL+GS Sbjct: 133 IGLAASNLGVVSCESPAYSIVLEFLLPLAVPLLLFRADLRRVIKSTGTLLLAFLIGS 189 >ref|XP_002513660.1| conserved hypothetical protein [Ricinus communis] gi|223547568|gb|EEF49063.1| conserved hypothetical protein [Ricinus communis] Length = 965 Score = 58.9 bits (141), Expect = 7e-07 Identities = 32/57 (56%), Positives = 36/57 (63%) Frame = +2 Query: 2 VGLATSNLGIISCEAPAYSXXXXXXXXXXXXXXXYRVDLGHVIQPIGTLLLAFLLGS 172 VGLA SNLGIISCE+PAY+ +R DL VI+ GTLLLAFLLGS Sbjct: 129 VGLAGSNLGIISCESPAYAVVLEFLLPLAVPLLLFRADLRRVIRSTGTLLLAFLLGS 185 >ref|XP_006829036.1| hypothetical protein AMTR_s00001p00253690 [Amborella trichopoda] gi|548834015|gb|ERM96452.1| hypothetical protein AMTR_s00001p00253690 [Amborella trichopoda] Length = 647 Score = 57.0 bits (136), Expect = 3e-06 Identities = 30/57 (52%), Positives = 34/57 (59%) Frame = +2 Query: 2 VGLATSNLGIISCEAPAYSXXXXXXXXXXXXXXXYRVDLGHVIQPIGTLLLAFLLGS 172 V LA SNLGII CEAPAYS ++ DL ++Q GTLLLAFLLGS Sbjct: 131 VALAASNLGIIGCEAPAYSIVMEYLLPLSVPLLLFKADLRRLVQSTGTLLLAFLLGS 187 >ref|XP_007038793.1| Keratin-associated protein 5-4 [Theobroma cacao] gi|508776038|gb|EOY23294.1| Keratin-associated protein 5-4 [Theobroma cacao] Length = 466 Score = 56.2 bits (134), Expect = 5e-06 Identities = 31/57 (54%), Positives = 34/57 (59%) Frame = +2 Query: 2 VGLATSNLGIISCEAPAYSXXXXXXXXXXXXXXXYRVDLGHVIQPIGTLLLAFLLGS 172 +GLA SNLGIISCEA AYS +R DL VI+ G LLLAFLLGS Sbjct: 133 IGLAASNLGIISCEAKAYSTVLEFLLPLAVPLLLFRADLRRVIKSTGKLLLAFLLGS 189