BLASTX nr result
ID: Paeonia25_contig00015528
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00015528 (467 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPT04085.1| hypothetical protein FOMPIDRAFT_1114520 [Fomitops... 55 8e-06 >gb|EPT04085.1| hypothetical protein FOMPIDRAFT_1114520 [Fomitopsis pinicola FP-58527 SS1] Length = 490 Score = 55.5 bits (132), Expect = 8e-06 Identities = 29/53 (54%), Positives = 38/53 (71%), Gaps = 3/53 (5%) Frame = -1 Query: 428 EDTDQSETISPKSKQNRASLPAYFSLLTLSTSA---QKAQRAPSSLDTTVSLS 279 ++ D TIS K K+NRASLPAYFSLLT STS+ ++QR PSSL T +++ Sbjct: 224 QEADYETTISSKPKRNRASLPAYFSLLTTSTSSPTPPRSQRTPSSLQTLTAIT 276