BLASTX nr result
ID: Paeonia25_contig00014605
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00014605 (448 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXB56029.1| Putative B3 domain-containing protein [Morus nota... 74 3e-11 emb|CAN75550.1| hypothetical protein VITISV_043543 [Vitis vinifera] 71 2e-10 ref|XP_006575462.1| PREDICTED: putative B3 domain-containing pro... 68 1e-09 gb|EYU46039.1| hypothetical protein MIMGU_mgv1a011106mg [Mimulus... 67 2e-09 ref|XP_007142002.1| hypothetical protein PHAVU_008G244300g [Phas... 67 2e-09 ref|XP_004490734.1| PREDICTED: neurofilament heavy polypeptide-l... 65 1e-08 ref|XP_004240433.1| PREDICTED: putative B3 domain-containing pro... 62 6e-08 ref|XP_002276000.1| PREDICTED: putative B3 domain-containing pro... 62 6e-08 ref|XP_006344089.1| PREDICTED: putative B3 domain-containing pro... 61 2e-07 ref|XP_006464978.1| PREDICTED: LOW QUALITY PROTEIN: putative B3 ... 60 3e-07 ref|XP_006432041.1| hypothetical protein CICLE_v10003383mg, part... 59 5e-07 emb|CBI15797.3| unnamed protein product [Vitis vinifera] 59 9e-07 ref|XP_003597798.1| B3 domain-containing protein [Medicago trunc... 58 1e-06 ref|XP_004296006.1| PREDICTED: putative B3 domain-containing pro... 56 6e-06 >gb|EXB56029.1| Putative B3 domain-containing protein [Morus notabilis] Length = 328 Score = 73.6 bits (179), Expect = 3e-11 Identities = 50/98 (51%), Positives = 60/98 (61%), Gaps = 7/98 (7%) Frame = -2 Query: 276 LLGNKMIDNCIINTYEETRKKQLEENRKRFEDLGILSICK---SLSNSGKKSQFKQ-ARP 109 +L K DN NTYEE RK++LEEN+KRFEDLGI S+ K L+NS KKSQ Q +P Sbjct: 1 MLTPKSNDNA--NTYEEARKQRLEENKKRFEDLGIASVSKGLTELTNSEKKSQQGQLPKP 58 Query: 108 KLKSTDVVERRCSSRATKPVTLYRCDDDTAW---RKKS 4 + K+ VE R S+R PV YR D D RKKS Sbjct: 59 RSKTAFAVEPRRSTRVRNPVQTYRYDVDMELPFSRKKS 96 >emb|CAN75550.1| hypothetical protein VITISV_043543 [Vitis vinifera] Length = 418 Score = 70.9 bits (172), Expect = 2e-10 Identities = 39/80 (48%), Positives = 52/80 (65%), Gaps = 3/80 (3%) Frame = -2 Query: 258 IDNCIINTYEETRKKQLEENRKRFEDLGILSICKSLS---NSGKKSQFKQARPKLKSTDV 88 + C+ ++YEE RK+ LEEN+KR EDLGIL I +SLS NS KSQ + +PK +S + Sbjct: 140 LTRCVFSSYEEARKQHLEENKKRLEDLGILKISQSLSXLTNSNSKSQKRPPKPKPESVYM 199 Query: 87 VERRCSSRATKPVTLYRCDD 28 +E R SSR V Y CD+ Sbjct: 200 LEPRRSSRVRNSVASY-CDE 218 >ref|XP_006575462.1| PREDICTED: putative B3 domain-containing protein At5g58280-like [Glycine max] Length = 407 Score = 67.8 bits (164), Expect = 1e-09 Identities = 42/81 (51%), Positives = 50/81 (61%), Gaps = 4/81 (4%) Frame = -2 Query: 261 MIDNCIINTYEETRKKQLEENRKRFEDLGILSICKSL---SNSGKKSQFKQARPKLKSTD 91 M C NTYEE RK++LEEN+KRFEDLGI I K+L ++S KK + K K T+ Sbjct: 1 MAKGCSNNTYEEARKQRLEENKKRFEDLGISRISKNLTEIASSAKKKLRHVPKQKTKKTN 60 Query: 90 V-VERRCSSRATKPVTLYRCD 31 V VE R SSR PV YR D Sbjct: 61 VEVEPRRSSRVRNPVRSYRED 81 >gb|EYU46039.1| hypothetical protein MIMGU_mgv1a011106mg [Mimulus guttatus] Length = 292 Score = 67.4 bits (163), Expect = 2e-09 Identities = 39/81 (48%), Positives = 49/81 (60%), Gaps = 2/81 (2%) Frame = -2 Query: 261 MIDNCIINTYEETRKKQLEENRKRFEDLGILSICKSLSNSGK--KSQFKQARPKLKSTDV 88 M + YEE RK++L EN+KRFEDLG+L + K+LSN K KSQ + R K + Sbjct: 1 MANESSATAYEEARKQRLLENQKRFEDLGLLKLSKNLSNLKKPEKSQNRHVRSKAADNFL 60 Query: 87 VERRCSSRATKPVTLYRCDDD 25 +E R SSRA PV YR D D Sbjct: 61 IEPRRSSRARNPVPSYRDDVD 81 >ref|XP_007142002.1| hypothetical protein PHAVU_008G244300g [Phaseolus vulgaris] gi|561015135|gb|ESW13996.1| hypothetical protein PHAVU_008G244300g [Phaseolus vulgaris] Length = 401 Score = 67.4 bits (163), Expect = 2e-09 Identities = 40/74 (54%), Positives = 50/74 (67%), Gaps = 4/74 (5%) Frame = -2 Query: 240 NTYEETRKKQLEENRKRFEDLGILSICKSL---SNSGKKSQFKQARPKLKSTD-VVERRC 73 NTYEE RK++LEEN+KRFEDLGI I K+L ++S KK Q +PK K+T+ VE R Sbjct: 8 NTYEEARKQRLEENKKRFEDLGISRISKNLNEITSSAKKRQHHVPKPKPKNTNGEVEPRR 67 Query: 72 SSRATKPVTLYRCD 31 SSR PV Y+ D Sbjct: 68 SSRVRNPVASYQED 81 >ref|XP_004490734.1| PREDICTED: neurofilament heavy polypeptide-like isoform X1 [Cicer arietinum] gi|502096433|ref|XP_004490735.1| PREDICTED: neurofilament heavy polypeptide-like isoform X2 [Cicer arietinum] Length = 701 Score = 64.7 bits (156), Expect = 1e-08 Identities = 37/71 (52%), Positives = 45/71 (63%), Gaps = 3/71 (4%) Frame = -2 Query: 240 NTYEETRKKQLEENRKRFEDLGILSICKSLS---NSGKKSQFKQARPKLKSTDVVERRCS 70 N YEE RK +LEEN+KRFEDLGI I K L+ + KKS + +P K+ VVE R S Sbjct: 6 NNYEEARKLRLEENKKRFEDLGISKISKKLTKIKSPAKKSPSRFLKPNSKTNGVVEPRRS 65 Query: 69 SRATKPVTLYR 37 SRA V+ YR Sbjct: 66 SRARNSVSSYR 76 >ref|XP_004240433.1| PREDICTED: putative B3 domain-containing protein At5g58280-like [Solanum lycopersicum] Length = 293 Score = 62.4 bits (150), Expect = 6e-08 Identities = 37/79 (46%), Positives = 52/79 (65%), Gaps = 7/79 (8%) Frame = -2 Query: 240 NTYEETRKKQLEENRKRFEDLGILSICKSLSN---SGKKSQFK----QARPKLKSTDVVE 82 N+YEE R++++ +N+KRFEDLGIL+I K+LS+ S KKS +K + R K K + E Sbjct: 7 NSYEELRRQRVLDNKKRFEDLGILNISKNLSDITKSEKKSDYKTELRRVRQKAKDVYLSE 66 Query: 81 RRCSSRATKPVTLYRCDDD 25 R S+RA PV YR + D Sbjct: 67 PRRSARARNPVPTYRDEID 85 >ref|XP_002276000.1| PREDICTED: putative B3 domain-containing protein At5g58280-like [Vitis vinifera] Length = 244 Score = 62.4 bits (150), Expect = 6e-08 Identities = 38/76 (50%), Positives = 50/76 (65%), Gaps = 5/76 (6%) Frame = -2 Query: 240 NTYEETRKKQLEENRKRFEDLGILSICKSLS---NSGKKSQFKQ--ARPKLKSTDVVERR 76 ++YEE RK+ LEEN+KR EDLGIL I +SLS NS KSQ ++ +PK +S ++E R Sbjct: 5 SSYEEARKQHLEENKKRLEDLGILKISQSLSLLTNSNSKSQIQKRPPKPKPESVYMLEPR 64 Query: 75 CSSRATKPVTLYRCDD 28 SSR V Y CD+ Sbjct: 65 RSSRVRNSVASY-CDE 79 >ref|XP_006344089.1| PREDICTED: putative B3 domain-containing protein At5g58280-like [Solanum tuberosum] Length = 290 Score = 60.8 bits (146), Expect = 2e-07 Identities = 36/79 (45%), Positives = 51/79 (64%), Gaps = 7/79 (8%) Frame = -2 Query: 240 NTYEETRKKQLEENRKRFEDLGILSICKSLSN---SGKKSQFK----QARPKLKSTDVVE 82 N+YEE R++++ +N+KRFEDLGIL+I K+LS+ S KKS +K + R K + E Sbjct: 7 NSYEEVRRQRVLDNKKRFEDLGILNISKNLSDITKSEKKSDYKTELRRVRQKANDVYMSE 66 Query: 81 RRCSSRATKPVTLYRCDDD 25 R S+RA PV YR + D Sbjct: 67 PRRSARARNPVPTYRDEID 85 >ref|XP_006464978.1| PREDICTED: LOW QUALITY PROTEIN: putative B3 domain-containing protein At5g58280-like [Citrus sinensis] Length = 427 Score = 60.1 bits (144), Expect = 3e-07 Identities = 42/79 (53%), Positives = 49/79 (62%), Gaps = 7/79 (8%) Frame = -2 Query: 240 NTYEETRKKQLEENRKRFEDLGILSICKS---LSNSGKKS-QFKQARPKLKSTDV---VE 82 NTYEE RKK+LEEN +R ++LGI I K+ LS S KKS Q ++ PK KS V VE Sbjct: 5 NTYEEARKKRLEENSQRLQELGIEKISKTLSQLSKSVKKSPQAQRHLPKFKSESVISIVE 64 Query: 81 RRCSSRATKPVTLYRCDDD 25 R SSRA V YR D D Sbjct: 65 PRRSSRARNSVVSYRDDLD 83 >ref|XP_006432041.1| hypothetical protein CICLE_v10003383mg, partial [Citrus clementina] gi|557534163|gb|ESR45281.1| hypothetical protein CICLE_v10003383mg, partial [Citrus clementina] Length = 81 Score = 59.3 bits (142), Expect = 5e-07 Identities = 41/77 (53%), Positives = 48/77 (62%), Gaps = 7/77 (9%) Frame = -2 Query: 240 NTYEETRKKQLEENRKRFEDLGILSICKS---LSNSGKKS-QFKQARPKLKSTDV---VE 82 NTYEE RKK+LEEN +R ++LGI I K+ LS S KKS Q ++ PK KS V VE Sbjct: 5 NTYEEARKKRLEENSQRLQELGIEKISKTLSQLSKSVKKSPQAQRHLPKFKSESVISIVE 64 Query: 81 RRCSSRATKPVTLYRCD 31 R SSRA V YR D Sbjct: 65 PRRSSRARNSVVSYRDD 81 >emb|CBI15797.3| unnamed protein product [Vitis vinifera] Length = 314 Score = 58.5 bits (140), Expect = 9e-07 Identities = 35/68 (51%), Positives = 44/68 (64%), Gaps = 3/68 (4%) Frame = -2 Query: 222 RKKQLEENRKRFEDLGILSICKSLS---NSGKKSQFKQARPKLKSTDVVERRCSSRATKP 52 RK+ LEEN+KR EDLGIL I +SLS NS KSQ + +PK +S ++E R SSR Sbjct: 9 RKQHLEENKKRLEDLGILKISQSLSLLTNSNSKSQKRPPKPKPESVYMLEPRRSSRVRNS 68 Query: 51 VTLYRCDD 28 V Y CD+ Sbjct: 69 VASY-CDE 75 >ref|XP_003597798.1| B3 domain-containing protein [Medicago truncatula] gi|355486846|gb|AES68049.1| B3 domain-containing protein [Medicago truncatula] Length = 727 Score = 58.2 bits (139), Expect = 1e-06 Identities = 37/82 (45%), Positives = 48/82 (58%), Gaps = 5/82 (6%) Frame = -2 Query: 270 GNKMIDNCII--NTYEETRKKQLEENRKRFEDLGILSICKSL---SNSGKKSQFKQARPK 106 G +M C N YE R+++L EN+KRFEDLGI I K+L ++ KKS + RPK Sbjct: 315 GAQMAKGCSTTSNNYEAAREQRLVENKKRFEDLGISKISKTLTEIASPAKKSTNRLFRPK 374 Query: 105 LKSTDVVERRCSSRATKPVTLY 40 K+ V+E R SSRA V Y Sbjct: 375 SKTNVVLEPRRSSRARNSVPSY 396 >ref|XP_004296006.1| PREDICTED: putative B3 domain-containing protein At5g58280-like [Fragaria vesca subsp. vesca] Length = 294 Score = 55.8 bits (133), Expect = 6e-06 Identities = 34/77 (44%), Positives = 48/77 (62%), Gaps = 3/77 (3%) Frame = -2 Query: 246 IINTYEETRKKQLEENRKRFEDLGILSICKSLSN--SGKKSQFKQARPKLKSTDV-VERR 76 ++ YEE R K+LEENRK+F+DLGI I K+LS+ + +K + +PK K+T VE R Sbjct: 1 MVAPYEEARNKRLEENRKKFQDLGITQISKTLSDLTAPEKKPQRVWKPKAKNTVFEVEPR 60 Query: 75 CSSRATKPVTLYRCDDD 25 S+R P+ Y D D Sbjct: 61 RSTRQRNPIQSYVDDVD 77