BLASTX nr result
ID: Paeonia25_contig00013350
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00013350 (1984 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007378769.1| hypothetical protein PUNSTDRAFT_140295 [Punc... 62 1e-06 gb|EPS98985.1| hypothetical protein FOMPIDRAFT_1024393 [Fomitops... 60 5e-06 gb|EPQ60305.1| hypothetical protein GLOTRDRAFT_135019 [Gloeophyl... 60 5e-06 >ref|XP_007378769.1| hypothetical protein PUNSTDRAFT_140295 [Punctularia strigosozonata HHB-11173 SS5] gi|390604461|gb|EIN13852.1| hypothetical protein PUNSTDRAFT_140295 [Punctularia strigosozonata HHB-11173 SS5] Length = 434 Score = 62.0 bits (149), Expect = 1e-06 Identities = 34/82 (41%), Positives = 46/82 (56%), Gaps = 5/82 (6%) Frame = +2 Query: 1067 KKIKSPPVTARTDPYQAPYFFPAPGSPEAADYIHKVRSD-RTFTRTVASWETP---EEPI 1234 +K SP T RT PY APYFFP+PGSPEA DY+ +VR + R + R AS + EP Sbjct: 278 RKSSSPKPTPRTQPYAAPYFFPSPGSPEATDYVRRVREERRQYPRRAASIDVTLPRTEPA 337 Query: 1235 LQVPKISPHDSGIT-LVESPIS 1297 P + +T V+ P++ Sbjct: 338 SSTPPVLAASPSLTPPVQPPVT 359 >gb|EPS98985.1| hypothetical protein FOMPIDRAFT_1024393 [Fomitopsis pinicola FP-58527 SS1] Length = 480 Score = 59.7 bits (143), Expect = 5e-06 Identities = 31/56 (55%), Positives = 36/56 (64%) Frame = +2 Query: 1019 SRENLPLREGIRKRRTKKIKSPPVTARTDPYQAPYFFPAPGSPEAADYIHKVRSDR 1186 S N+PL + RR +P ARTDPYQAPYFFP P SPEAADY+ +VR R Sbjct: 251 SPTNMPLPKKWLPRRQNTAPAP--LARTDPYQAPYFFPTPLSPEAADYVRQVRISR 304 >gb|EPQ60305.1| hypothetical protein GLOTRDRAFT_135019 [Gloeophyllum trabeum ATCC 11539] Length = 439 Score = 59.7 bits (143), Expect = 5e-06 Identities = 26/39 (66%), Positives = 31/39 (79%) Frame = +2 Query: 1070 KIKSPPVTARTDPYQAPYFFPAPGSPEAADYIHKVRSDR 1186 K+ SPP RT+PY+APYFFP PGSPEA DY+ +VR DR Sbjct: 321 KLPSPP--PRTNPYEAPYFFPQPGSPEAQDYVRRVREDR 357