BLASTX nr result
ID: Paeonia25_contig00011840
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00011840 (225 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMD31044.1| hypothetical protein CERSUDRAFT_120163 [Ceriporio... 59 2e-10 gb|ETW76945.1| hypothetical protein HETIRDRAFT_422294 [Heterobas... 56 3e-10 gb|EEB06667.2| cyclophilin family peptidyl-prolyl cis-trans isom... 53 2e-09 ref|XP_002172960.1| peptidyl-prolyl cis-trans isomerase [Schizos... 53 2e-09 ref|XP_007306846.1| Der f Mal f 6 allergen [Stereum hirsutum FP-... 54 2e-09 gb|EMR09105.1| hypothetical protein PNEG_02449 [Pneumocystis mur... 57 3e-09 ref|XP_002381019.1| peptidyl-prolyl cis-trans isomerase [Aspergi... 56 6e-09 ref|XP_001824186.1| peptidyl-prolyl cis-trans isomerase [Aspergi... 53 6e-09 emb|CCM05682.1| predicted protein [Fibroporia radiculosa] 55 8e-09 gb|ERS96474.1| hypothetical protein HMPREF1624_07387 [Sporothrix... 52 1e-08 emb|CCF50505.1| probable CPR1-cyclophilin (peptidylprolyl isomer... 52 2e-08 ref|XP_001823957.2| peptidyl-prolyl cis-trans isomerase [Aspergi... 54 2e-08 dbj|BAE62824.1| unnamed protein product [Aspergillus oryzae RIB40] 54 2e-08 ref|WP_018103809.1| peptidylprolyl isomerase [Streptomyces] 52 2e-08 ref|XP_007269436.1| cyclophilin [Fomitiporia mediterranea MF3/22... 54 2e-08 gb|EPQ50369.1| cyclophilin 1 [Gloeophyllum trabeum ATCC 11539] 52 3e-08 ref|NP_595664.1| cyclophilin family peptidyl-prolyl cis-trans is... 54 3e-08 gb|EPY49176.1| cyclophilin family peptidyl-prolyl cis-trans isom... 54 3e-08 gb|EPX72244.1| cyclophilin family peptidyl-prolyl cis-trans isom... 54 3e-08 gb|EFX04101.1| peptidyl-prolyl cis-trans isomerase [Grosmannia c... 52 4e-08 >gb|EMD31044.1| hypothetical protein CERSUDRAFT_120163 [Ceriporiopsis subvermispora B] Length = 174 Score = 58.9 bits (141), Expect(2) = 2e-10 Identities = 26/33 (78%), Positives = 29/33 (87%) Frame = -1 Query: 99 FISPFPDESFRIKHDKPGLLSMANRGPNTNTSQ 1 F PF DESFR +HD+PG+LSMANRGPNTNTSQ Sbjct: 87 FGKPFADESFRHRHDRPGVLSMANRGPNTNTSQ 119 Score = 32.3 bits (72), Expect(2) = 2e-10 Identities = 18/34 (52%), Positives = 21/34 (61%), Gaps = 2/34 (5%) Frame = -2 Query: 224 FNIQGGDLFAPDEPIR--PGCGGRSIYGHPFPGE 129 F IQGGD+ PD R G GGRS++G PF E Sbjct: 63 FMIQGGDI--PDAAGRGGDGAGGRSVFGKPFADE 94 >gb|ETW76945.1| hypothetical protein HETIRDRAFT_422294 [Heterobasidion irregulare TC 32-1] Length = 158 Score = 56.2 bits (134), Expect(2) = 3e-10 Identities = 23/29 (79%), Positives = 28/29 (96%) Frame = -1 Query: 87 FPDESFRIKHDKPGLLSMANRGPNTNTSQ 1 FPDE+FR++HDKPGLLSMANRGP +N+SQ Sbjct: 74 FPDENFRLRHDKPGLLSMANRGPRSNSSQ 102 Score = 33.9 bits (76), Expect(2) = 3e-10 Identities = 18/33 (54%), Positives = 20/33 (60%) Frame = -2 Query: 224 FNIQGGDLFAPDEPIRPGCGGRSIYGHPFPGEH 126 F IQGGD+ D G GGRSIYG FP E+ Sbjct: 51 FMIQGGDITQRD-----GSGGRSIYGPTFPDEN 78 >gb|EEB06667.2| cyclophilin family peptidyl-prolyl cis-trans isomerase Cyp2 [Schizosaccharomyces japonicus yFS275] Length = 163 Score = 52.8 bits (125), Expect(2) = 2e-09 Identities = 23/29 (79%), Positives = 26/29 (89%) Frame = -1 Query: 87 FPDESFRIKHDKPGLLSMANRGPNTNTSQ 1 FPDE+F +KH+KPGLLSMAN GPNTN SQ Sbjct: 81 FPDENFVLKHNKPGLLSMANAGPNTNGSQ 109 Score = 35.0 bits (79), Expect(2) = 2e-09 Identities = 17/33 (51%), Positives = 20/33 (60%) Frame = -2 Query: 224 FNIQGGDLFAPDEPIRPGCGGRSIYGHPFPGEH 126 F +QGGD D G GG+SIYGH FP E+ Sbjct: 58 FMLQGGDFTRGD-----GTGGKSIYGHKFPDEN 85 >ref|XP_002172960.1| peptidyl-prolyl cis-trans isomerase [Schizosaccharomyces japonicus yFS275] Length = 160 Score = 52.8 bits (125), Expect(2) = 2e-09 Identities = 23/29 (79%), Positives = 26/29 (89%) Frame = -1 Query: 87 FPDESFRIKHDKPGLLSMANRGPNTNTSQ 1 FPDE+F +KH+KPGLLSMAN GPNTN SQ Sbjct: 78 FPDENFVLKHNKPGLLSMANAGPNTNGSQ 106 Score = 35.0 bits (79), Expect(2) = 2e-09 Identities = 17/33 (51%), Positives = 20/33 (60%) Frame = -2 Query: 224 FNIQGGDLFAPDEPIRPGCGGRSIYGHPFPGEH 126 F +QGGD D G GG+SIYGH FP E+ Sbjct: 55 FMLQGGDFTRGD-----GTGGKSIYGHKFPDEN 82 >ref|XP_007306846.1| Der f Mal f 6 allergen [Stereum hirsutum FP-91666 SS1] gi|389742919|gb|EIM84105.1| Der f Mal f 6 allergen [Stereum hirsutum FP-91666 SS1] Length = 168 Score = 53.9 bits (128), Expect(2) = 2e-09 Identities = 22/31 (70%), Positives = 27/31 (87%) Frame = -1 Query: 93 SPFPDESFRIKHDKPGLLSMANRGPNTNTSQ 1 S FPDESF ++HD+PGLLSM +RGP TN+SQ Sbjct: 81 SSFPDESFEVRHDRPGLLSMGSRGPGTNSSQ 111 Score = 33.5 bits (75), Expect(2) = 2e-09 Identities = 18/32 (56%), Positives = 19/32 (59%) Frame = -2 Query: 224 FNIQGGDLFAPDEPIRPGCGGRSIYGHPFPGE 129 F IQGGD+ D G GGRSIYG FP E Sbjct: 60 FMIQGGDITNGD-----GTGGRSIYGSSFPDE 86 >gb|EMR09105.1| hypothetical protein PNEG_02449 [Pneumocystis murina B123] Length = 162 Score = 56.6 bits (135), Expect(2) = 3e-09 Identities = 24/29 (82%), Positives = 27/29 (93%) Frame = -1 Query: 87 FPDESFRIKHDKPGLLSMANRGPNTNTSQ 1 FPDE+F++KHDKPGLLSMAN GPNTN SQ Sbjct: 81 FPDENFKLKHDKPGLLSMANAGPNTNGSQ 109 Score = 30.4 bits (67), Expect(2) = 3e-09 Identities = 16/33 (48%), Positives = 19/33 (57%) Frame = -2 Query: 224 FNIQGGDLFAPDEPIRPGCGGRSIYGHPFPGEH 126 F IQGGD + G GG+SIYG FP E+ Sbjct: 58 FMIQGGDFTRHN-----GTGGKSIYGERFPDEN 85 >ref|XP_002381019.1| peptidyl-prolyl cis-trans isomerase [Aspergillus flavus NRRL3357] gi|220692772|gb|EED49118.1| peptidyl-prolyl cis-trans isomerase [Aspergillus flavus NRRL3357] Length = 215 Score = 55.8 bits (133), Expect(2) = 6e-09 Identities = 24/29 (82%), Positives = 26/29 (89%) Frame = -1 Query: 87 FPDESFRIKHDKPGLLSMANRGPNTNTSQ 1 FPDE+F+ KHDKPGLLSMAN GPNTN SQ Sbjct: 130 FPDENFKFKHDKPGLLSMANAGPNTNGSQ 158 Score = 30.0 bits (66), Expect(2) = 6e-09 Identities = 15/33 (45%), Positives = 19/33 (57%) Frame = -2 Query: 224 FNIQGGDLFAPDEPIRPGCGGRSIYGHPFPGEH 126 F +QGGD + G GG+SIYG FP E+ Sbjct: 107 FMLQGGDFTRGN-----GTGGKSIYGEKFPDEN 134 >ref|XP_001824186.1| peptidyl-prolyl cis-trans isomerase [Aspergillus oryzae RIB40] gi|238500083|ref|XP_002381276.1| peptidyl-prolyl cis-trans isomerase/cyclophilin, putative [Aspergillus flavus NRRL3357] gi|83772925|dbj|BAE63053.1| unnamed protein product [Aspergillus oryzae RIB40] gi|220693029|gb|EED49375.1| peptidyl-prolyl cis-trans isomerase/cyclophilin, putative [Aspergillus flavus NRRL3357] gi|391870300|gb|EIT79485.1| cyclophilin type peptidyl-prolyl cis-trans isomerase [Aspergillus oryzae 3.042] Length = 165 Score = 52.8 bits (125), Expect(2) = 6e-09 Identities = 22/29 (75%), Positives = 26/29 (89%) Frame = -1 Query: 87 FPDESFRIKHDKPGLLSMANRGPNTNTSQ 1 FPDE+F++KHD+PGLLSMAN GP TN SQ Sbjct: 83 FPDENFQLKHDRPGLLSMANAGPGTNGSQ 111 Score = 33.1 bits (74), Expect(2) = 6e-09 Identities = 17/33 (51%), Positives = 19/33 (57%) Frame = -2 Query: 224 FNIQGGDLFAPDEPIRPGCGGRSIYGHPFPGEH 126 F +QGGD D G GGRSIYG FP E+ Sbjct: 60 FMLQGGDFTRGD-----GTGGRSIYGETFPDEN 87 >emb|CCM05682.1| predicted protein [Fibroporia radiculosa] Length = 180 Score = 54.7 bits (130), Expect(2) = 8e-09 Identities = 23/28 (82%), Positives = 27/28 (96%) Frame = -1 Query: 87 FPDESFRIKHDKPGLLSMANRGPNTNTS 4 F DE+FR+KHDKPGLLSMANRGPN+N+S Sbjct: 97 FADENFRLKHDKPGLLSMANRGPNSNSS 124 Score = 30.8 bits (68), Expect(2) = 8e-09 Identities = 17/33 (51%), Positives = 19/33 (57%) Frame = -2 Query: 224 FNIQGGDLFAPDEPIRPGCGGRSIYGHPFPGEH 126 F IQGGD+ D G GGRSIYG F E+ Sbjct: 74 FMIQGGDIQGGD-----GAGGRSIYGPRFADEN 101 >gb|ERS96474.1| hypothetical protein HMPREF1624_07387 [Sporothrix schenckii ATCC 58251] Length = 186 Score = 52.4 bits (124), Expect(2) = 1e-08 Identities = 22/29 (75%), Positives = 26/29 (89%) Frame = -1 Query: 87 FPDESFRIKHDKPGLLSMANRGPNTNTSQ 1 FPDE+F++KHD+ GLLSMAN GPNTN SQ Sbjct: 101 FPDENFKLKHDREGLLSMANAGPNTNGSQ 129 Score = 32.3 bits (72), Expect(2) = 1e-08 Identities = 17/33 (51%), Positives = 19/33 (57%) Frame = -2 Query: 224 FNIQGGDLFAPDEPIRPGCGGRSIYGHPFPGEH 126 F IQGGD + G GGRSIYG FP E+ Sbjct: 78 FMIQGGDFTRQN-----GTGGRSIYGEKFPDEN 105 >emb|CCF50505.1| probable CPR1-cyclophilin (peptidylprolyl isomerase) [Ustilago hordei] Length = 177 Score = 52.4 bits (124), Expect(2) = 2e-08 Identities = 22/29 (75%), Positives = 26/29 (89%) Frame = -1 Query: 87 FPDESFRIKHDKPGLLSMANRGPNTNTSQ 1 FPDE+F++ H+KPGLLSMAN GPNTN SQ Sbjct: 96 FPDENFKLTHNKPGLLSMANAGPNTNGSQ 124 Score = 32.0 bits (71), Expect(2) = 2e-08 Identities = 16/33 (48%), Positives = 20/33 (60%) Frame = -2 Query: 224 FNIQGGDLFAPDEPIRPGCGGRSIYGHPFPGEH 126 F +QGGD A + G GG+SIYG FP E+ Sbjct: 73 FMLQGGDFTAGN-----GTGGKSIYGEKFPDEN 100 >ref|XP_001823957.2| peptidyl-prolyl cis-trans isomerase [Aspergillus oryzae RIB40] gi|391869345|gb|EIT78544.1| cyclophilin type peptidyl-prolyl cis-trans isomerase [Aspergillus oryzae 3.042] Length = 215 Score = 53.9 bits (128), Expect(2) = 2e-08 Identities = 23/29 (79%), Positives = 26/29 (89%) Frame = -1 Query: 87 FPDESFRIKHDKPGLLSMANRGPNTNTSQ 1 FPDE+F+ KH+KPGLLSMAN GPNTN SQ Sbjct: 130 FPDENFKFKHNKPGLLSMANAGPNTNGSQ 158 Score = 30.0 bits (66), Expect(2) = 2e-08 Identities = 15/33 (45%), Positives = 19/33 (57%) Frame = -2 Query: 224 FNIQGGDLFAPDEPIRPGCGGRSIYGHPFPGEH 126 F +QGGD + G GG+SIYG FP E+ Sbjct: 107 FMLQGGDFTRGN-----GTGGKSIYGEKFPDEN 134 >dbj|BAE62824.1| unnamed protein product [Aspergillus oryzae RIB40] Length = 173 Score = 53.9 bits (128), Expect(2) = 2e-08 Identities = 23/29 (79%), Positives = 26/29 (89%) Frame = -1 Query: 87 FPDESFRIKHDKPGLLSMANRGPNTNTSQ 1 FPDE+F+ KH+KPGLLSMAN GPNTN SQ Sbjct: 88 FPDENFKFKHNKPGLLSMANAGPNTNGSQ 116 Score = 30.0 bits (66), Expect(2) = 2e-08 Identities = 15/33 (45%), Positives = 19/33 (57%) Frame = -2 Query: 224 FNIQGGDLFAPDEPIRPGCGGRSIYGHPFPGEH 126 F +QGGD + G GG+SIYG FP E+ Sbjct: 65 FMLQGGDFTRGN-----GTGGKSIYGEKFPDEN 92 >ref|WP_018103809.1| peptidylprolyl isomerase [Streptomyces] Length = 165 Score = 51.6 bits (122), Expect(2) = 2e-08 Identities = 22/29 (75%), Positives = 25/29 (86%) Frame = -1 Query: 87 FPDESFRIKHDKPGLLSMANRGPNTNTSQ 1 FPDE+F +KH KPGLLSMAN GPN+N SQ Sbjct: 82 FPDENFELKHTKPGLLSMANAGPNSNGSQ 110 Score = 32.3 bits (72), Expect(2) = 2e-08 Identities = 16/33 (48%), Positives = 20/33 (60%) Frame = -2 Query: 224 FNIQGGDLFAPDEPIRPGCGGRSIYGHPFPGEH 126 F +QGGD D G GG+SIYG+ FP E+ Sbjct: 59 FMLQGGDFTRGD-----GTGGKSIYGNKFPDEN 86 >ref|XP_007269436.1| cyclophilin [Fomitiporia mediterranea MF3/22] gi|393215171|gb|EJD00663.1| cyclophilin [Fomitiporia mediterranea MF3/22] Length = 162 Score = 53.5 bits (127), Expect(2) = 2e-08 Identities = 22/29 (75%), Positives = 27/29 (93%) Frame = -1 Query: 87 FPDESFRIKHDKPGLLSMANRGPNTNTSQ 1 FPDE+F+++H+KPGLLSMAN GPNTN SQ Sbjct: 81 FPDENFKLRHNKPGLLSMANAGPNTNGSQ 109 Score = 30.4 bits (67), Expect(2) = 2e-08 Identities = 16/33 (48%), Positives = 19/33 (57%) Frame = -2 Query: 224 FNIQGGDLFAPDEPIRPGCGGRSIYGHPFPGEH 126 F IQGGD + G GG+SIYG FP E+ Sbjct: 58 FMIQGGDFTRHN-----GTGGKSIYGERFPDEN 85 >gb|EPQ50369.1| cyclophilin 1 [Gloeophyllum trabeum ATCC 11539] Length = 173 Score = 52.4 bits (124), Expect(2) = 3e-08 Identities = 22/29 (75%), Positives = 27/29 (93%) Frame = -1 Query: 87 FPDESFRIKHDKPGLLSMANRGPNTNTSQ 1 F DE+F ++HD+PGLLSMANRGPNTN+SQ Sbjct: 87 FADENFFLQHDRPGLLSMANRGPNTNSSQ 115 Score = 31.2 bits (69), Expect(2) = 3e-08 Identities = 17/36 (47%), Positives = 21/36 (58%) Frame = -2 Query: 224 FNIQGGDLFAPDEPIRPGCGGRSIYGHPFPGEHGYI 117 F IQGGD+ D G GGRSIYG F E+ ++ Sbjct: 64 FMIQGGDITRRD-----GTGGRSIYGDYFADENFFL 94 >ref|NP_595664.1| cyclophilin family peptidyl-prolyl cis-trans isomerase Cyp2 [Schizosaccharomyces pombe 972h-] gi|118109|sp|P18253.1|CYPH_SCHPO RecName: Full=Peptidyl-prolyl cis-trans isomerase; Short=PPIase; AltName: Full=Cyclophilin; Short=CPH; AltName: Full=Cyclosporin A-binding protein; AltName: Full=Rotamase gi|5016|emb|CAA37322.1| unnamed protein product [Schizosaccharomyces pombe] gi|1236258|dbj|BAA12183.1| peptidyl-prolyl cis-trans isomerase [Schizosaccharomyces pombe] gi|6018687|emb|CAB57932.1| cyclophilin family peptidyl-prolyl cis-trans isomerase Cyp2 [Schizosaccharomyces pombe] Length = 162 Score = 53.5 bits (127), Expect(2) = 3e-08 Identities = 23/29 (79%), Positives = 26/29 (89%) Frame = -1 Query: 87 FPDESFRIKHDKPGLLSMANRGPNTNTSQ 1 FPDE+F +KH+KPGLLSMAN GPNTN SQ Sbjct: 81 FPDENFALKHNKPGLLSMANAGPNTNGSQ 109 Score = 30.0 bits (66), Expect(2) = 3e-08 Identities = 15/33 (45%), Positives = 19/33 (57%) Frame = -2 Query: 224 FNIQGGDLFAPDEPIRPGCGGRSIYGHPFPGEH 126 F +QGGD + G GG+SIYG FP E+ Sbjct: 58 FMLQGGDFTRGN-----GTGGKSIYGEKFPDEN 85 >gb|EPY49176.1| cyclophilin family peptidyl-prolyl cis-trans isomerase Cyp2 [Schizosaccharomyces cryophilus OY26] Length = 162 Score = 53.5 bits (127), Expect(2) = 3e-08 Identities = 23/29 (79%), Positives = 26/29 (89%) Frame = -1 Query: 87 FPDESFRIKHDKPGLLSMANRGPNTNTSQ 1 FPDE+F +KH+KPGLLSMAN GPNTN SQ Sbjct: 81 FPDENFTLKHNKPGLLSMANAGPNTNGSQ 109 Score = 30.0 bits (66), Expect(2) = 3e-08 Identities = 15/33 (45%), Positives = 19/33 (57%) Frame = -2 Query: 224 FNIQGGDLFAPDEPIRPGCGGRSIYGHPFPGEH 126 F +QGGD + G GG+SIYG FP E+ Sbjct: 58 FMLQGGDFTRGN-----GTGGKSIYGEKFPDEN 85 >gb|EPX72244.1| cyclophilin family peptidyl-prolyl cis-trans isomerase Cyp2 [Schizosaccharomyces octosporus yFS286] Length = 162 Score = 53.5 bits (127), Expect(2) = 3e-08 Identities = 23/29 (79%), Positives = 26/29 (89%) Frame = -1 Query: 87 FPDESFRIKHDKPGLLSMANRGPNTNTSQ 1 FPDE+F +KH+KPGLLSMAN GPNTN SQ Sbjct: 81 FPDENFSLKHNKPGLLSMANAGPNTNGSQ 109 Score = 30.0 bits (66), Expect(2) = 3e-08 Identities = 15/33 (45%), Positives = 19/33 (57%) Frame = -2 Query: 224 FNIQGGDLFAPDEPIRPGCGGRSIYGHPFPGEH 126 F +QGGD + G GG+SIYG FP E+ Sbjct: 58 FMLQGGDFTRGN-----GTGGKSIYGEKFPDEN 85 >gb|EFX04101.1| peptidyl-prolyl cis-trans isomerase [Grosmannia clavigera kw1407] Length = 181 Score = 52.0 bits (123), Expect(2) = 4e-08 Identities = 22/29 (75%), Positives = 26/29 (89%) Frame = -1 Query: 87 FPDESFRIKHDKPGLLSMANRGPNTNTSQ 1 FPDE+F++KHD+P LLSMAN GPNTN SQ Sbjct: 95 FPDENFKLKHDRPFLLSMANAGPNTNGSQ 123 Score = 31.2 bits (69), Expect(2) = 4e-08 Identities = 16/33 (48%), Positives = 19/33 (57%) Frame = -2 Query: 224 FNIQGGDLFAPDEPIRPGCGGRSIYGHPFPGEH 126 F +QGGD + G GGRSIYG FP E+ Sbjct: 72 FMLQGGDFTRGN-----GTGGRSIYGEKFPDEN 99