BLASTX nr result
ID: Paeonia25_contig00011664
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00011664 (385 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002534131.1| Thioredoxin H-type [Ricinus communis] gi|111... 124 2e-26 ref|XP_004232447.1| PREDICTED: thioredoxin H-type 2-like [Solanu... 122 5e-26 ref|NP_001275313.1| thioredoxin H-type 2-like [Solanum tuberosum... 122 5e-26 ref|XP_006425592.1| hypothetical protein CICLE_v10026781mg [Citr... 122 7e-26 ref|XP_006425591.1| hypothetical protein CICLE_v10026781mg [Citr... 122 7e-26 gb|ADN96593.1| thioredoxin h [Vitis vinifera] 121 9e-26 emb|CBI17430.3| unnamed protein product [Vitis vinifera] 121 9e-26 ref|XP_002274205.1| PREDICTED: thioredoxin H-type 2 [Vitis vinif... 121 9e-26 gb|EYU31166.1| hypothetical protein MIMGU_mgv1a015811mg [Mimulus... 121 1e-25 ref|XP_007046793.1| Thioredoxin H-type 1, H1,TRX1 [Theobroma cac... 121 1e-25 sp|Q07090.1|TRXH2_TOBAC RecName: Full=Thioredoxin H-type 2; Shor... 121 1e-25 ref|XP_007202766.1| hypothetical protein PRUPE_ppa013476mg [Prun... 120 2e-25 ref|XP_004287851.1| PREDICTED: thioredoxin H-type-like [Fragaria... 119 3e-25 ref|XP_004158908.1| PREDICTED: thioredoxin H-type-like [Cucumis ... 116 3e-24 ref|XP_004149979.1| PREDICTED: thioredoxin H-type-like [Cucumis ... 116 3e-24 ref|XP_002310830.2| thioredoxin h family protein [Populus tricho... 116 4e-24 gb|EXC35509.1| Thioredoxin H-type [Morus notabilis] 115 5e-24 ref|XP_006292776.1| hypothetical protein CARUB_v10019026mg [Caps... 115 5e-24 gb|AEC03316.1| thioredoxin H-type 2 [Hevea brasiliensis] 115 6e-24 ref|NP_190672.1| thioredoxin H1 [Arabidopsis thaliana] gi|297819... 113 2e-23 >ref|XP_002534131.1| Thioredoxin H-type [Ricinus communis] gi|11135282|sp|Q43636.1|TRXH_RICCO RecName: Full=Thioredoxin H-type; Short=Trx-H gi|1255954|emb|CAA94534.1| thioredoxin [Ricinus communis] gi|223525803|gb|EEF28248.1| Thioredoxin H-type [Ricinus communis] Length = 118 Score = 124 bits (310), Expect = 2e-26 Identities = 60/69 (86%), Positives = 67/69 (97%) Frame = -2 Query: 384 FLVELAKKLPDVTFLKVDVDELKSIAADWAVEAMPTFMFLKEGKILDKVVGAKKDELQQT 205 FL ELAKKLP+VTFLKVDVDELK++A +WAVE+MPTFMFLKEGKI+DKVVGAKKDELQQT Sbjct: 49 FLAELAKKLPNVTFLKVDVDELKTVAHEWAVESMPTFMFLKEGKIMDKVVGAKKDELQQT 108 Query: 204 IAKHMSTAS 178 IAKHM+TAS Sbjct: 109 IAKHMATAS 117 >ref|XP_004232447.1| PREDICTED: thioredoxin H-type 2-like [Solanum lycopersicum] Length = 118 Score = 122 bits (306), Expect = 5e-26 Identities = 59/69 (85%), Positives = 65/69 (94%) Frame = -2 Query: 384 FLVELAKKLPDVTFLKVDVDELKSIAADWAVEAMPTFMFLKEGKILDKVVGAKKDELQQT 205 FL ELAKK+P VTFLKVDVDELKS+A DWAVEAMPTFMF+KEGKI+DKVVGAKKDELQQT Sbjct: 48 FLAELAKKIPTVTFLKVDVDELKSVATDWAVEAMPTFMFIKEGKIVDKVVGAKKDELQQT 107 Query: 204 IAKHMSTAS 178 IAKH+S+ S Sbjct: 108 IAKHISSTS 116 >ref|NP_001275313.1| thioredoxin H-type 2-like [Solanum tuberosum] gi|418730025|gb|AFX66981.1| thioredoxin H-type 2 [Solanum tuberosum] Length = 118 Score = 122 bits (306), Expect = 5e-26 Identities = 59/69 (85%), Positives = 65/69 (94%) Frame = -2 Query: 384 FLVELAKKLPDVTFLKVDVDELKSIAADWAVEAMPTFMFLKEGKILDKVVGAKKDELQQT 205 FL ELAKK+P VTFLKVDVDELKS+A DWAVEAMPTFMF+KEGKI+DKVVGAKKDELQQT Sbjct: 48 FLAELAKKIPTVTFLKVDVDELKSVATDWAVEAMPTFMFIKEGKIVDKVVGAKKDELQQT 107 Query: 204 IAKHMSTAS 178 IAKH+S+ S Sbjct: 108 IAKHISSTS 116 >ref|XP_006425592.1| hypothetical protein CICLE_v10026781mg [Citrus clementina] gi|557527582|gb|ESR38832.1| hypothetical protein CICLE_v10026781mg [Citrus clementina] Length = 120 Score = 122 bits (305), Expect = 7e-26 Identities = 59/69 (85%), Positives = 66/69 (95%) Frame = -2 Query: 384 FLVELAKKLPDVTFLKVDVDELKSIAADWAVEAMPTFMFLKEGKILDKVVGAKKDELQQT 205 FL ELAKKLP+V FLKVDVDELKS+A DWAVEAMPTFMFLKEGKI+DKVVG+KK+ELQQT Sbjct: 51 FLAELAKKLPNVLFLKVDVDELKSVATDWAVEAMPTFMFLKEGKIVDKVVGSKKEELQQT 110 Query: 204 IAKHMSTAS 178 IAKH++TAS Sbjct: 111 IAKHLATAS 119 >ref|XP_006425591.1| hypothetical protein CICLE_v10026781mg [Citrus clementina] gi|568824998|ref|XP_006466877.1| PREDICTED: thioredoxin H-type-like [Citrus sinensis] gi|119367477|gb|ABL67654.1| putative H-type thioredoxin [Citrus hybrid cultivar] gi|557527581|gb|ESR38831.1| hypothetical protein CICLE_v10026781mg [Citrus clementina] Length = 119 Score = 122 bits (305), Expect = 7e-26 Identities = 59/69 (85%), Positives = 66/69 (95%) Frame = -2 Query: 384 FLVELAKKLPDVTFLKVDVDELKSIAADWAVEAMPTFMFLKEGKILDKVVGAKKDELQQT 205 FL ELAKKLP+V FLKVDVDELKS+A DWAVEAMPTFMFLKEGKI+DKVVG+KK+ELQQT Sbjct: 50 FLAELAKKLPNVLFLKVDVDELKSVATDWAVEAMPTFMFLKEGKIVDKVVGSKKEELQQT 109 Query: 204 IAKHMSTAS 178 IAKH++TAS Sbjct: 110 IAKHLATAS 118 >gb|ADN96593.1| thioredoxin h [Vitis vinifera] Length = 115 Score = 121 bits (304), Expect = 9e-26 Identities = 59/68 (86%), Positives = 64/68 (94%) Frame = -2 Query: 384 FLVELAKKLPDVTFLKVDVDELKSIAADWAVEAMPTFMFLKEGKILDKVVGAKKDELQQT 205 FLVELAKK+P VTFLKVDVDELKS+A DWAVEAMPTFMFLK+GKI+DKVVGA KD LQQT Sbjct: 48 FLVELAKKIPTVTFLKVDVDELKSVATDWAVEAMPTFMFLKQGKIVDKVVGANKDSLQQT 107 Query: 204 IAKHMSTA 181 IAKHM+TA Sbjct: 108 IAKHMATA 115 >emb|CBI17430.3| unnamed protein product [Vitis vinifera] Length = 152 Score = 121 bits (304), Expect = 9e-26 Identities = 59/68 (86%), Positives = 64/68 (94%) Frame = -2 Query: 384 FLVELAKKLPDVTFLKVDVDELKSIAADWAVEAMPTFMFLKEGKILDKVVGAKKDELQQT 205 FLVELAKK+P VTFLKVDVDELKS+A DWAVEAMPTFMFLK+GKI+DKVVGA KD LQQT Sbjct: 85 FLVELAKKIPTVTFLKVDVDELKSVATDWAVEAMPTFMFLKQGKIVDKVVGANKDSLQQT 144 Query: 204 IAKHMSTA 181 IAKHM+TA Sbjct: 145 IAKHMATA 152 >ref|XP_002274205.1| PREDICTED: thioredoxin H-type 2 [Vitis vinifera] gi|452114364|gb|AGG09339.1| thioredoxin h1 [Vitis vinifera] Length = 115 Score = 121 bits (304), Expect = 9e-26 Identities = 59/68 (86%), Positives = 64/68 (94%) Frame = -2 Query: 384 FLVELAKKLPDVTFLKVDVDELKSIAADWAVEAMPTFMFLKEGKILDKVVGAKKDELQQT 205 FLVELAKK+P VTFLKVDVDELKS+A DWAVEAMPTFMFLK+GKI+DKVVGA KD LQQT Sbjct: 48 FLVELAKKIPTVTFLKVDVDELKSVATDWAVEAMPTFMFLKQGKIVDKVVGANKDSLQQT 107 Query: 204 IAKHMSTA 181 IAKHM+TA Sbjct: 108 IAKHMATA 115 >gb|EYU31166.1| hypothetical protein MIMGU_mgv1a015811mg [Mimulus guttatus] Length = 145 Score = 121 bits (303), Expect = 1e-25 Identities = 59/69 (85%), Positives = 65/69 (94%) Frame = -2 Query: 384 FLVELAKKLPDVTFLKVDVDELKSIAADWAVEAMPTFMFLKEGKILDKVVGAKKDELQQT 205 F ELAKKLP+VTFLKVDVDELKS+A+DWAVEAMPTF+FLKEGKILD+VVGAKKDELQQ Sbjct: 74 FFAELAKKLPNVTFLKVDVDELKSVASDWAVEAMPTFIFLKEGKILDRVVGAKKDELQQI 133 Query: 204 IAKHMSTAS 178 IAKH +TAS Sbjct: 134 IAKHQNTAS 142 >ref|XP_007046793.1| Thioredoxin H-type 1, H1,TRX1 [Theobroma cacao] gi|508699054|gb|EOX90950.1| Thioredoxin H-type 1, H1,TRX1 [Theobroma cacao] Length = 118 Score = 121 bits (303), Expect = 1e-25 Identities = 58/69 (84%), Positives = 65/69 (94%) Frame = -2 Query: 384 FLVELAKKLPDVTFLKVDVDELKSIAADWAVEAMPTFMFLKEGKILDKVVGAKKDELQQT 205 FL ELAKKLP+V FLKVDVDELK +A DWAVEAMPTFMFLKEGKI+DKVVGAKKD+LQQT Sbjct: 49 FLAELAKKLPNVMFLKVDVDELKEVATDWAVEAMPTFMFLKEGKIVDKVVGAKKDDLQQT 108 Query: 204 IAKHMSTAS 178 +AKHM++AS Sbjct: 109 VAKHMASAS 117 >sp|Q07090.1|TRXH2_TOBAC RecName: Full=Thioredoxin H-type 2; Short=Trx-H2 gi|297519|emb|CAA77847.1| THIOREDOXIN [Nicotiana tabacum] gi|447151|prf||1913431A thioredoxin Length = 118 Score = 121 bits (303), Expect = 1e-25 Identities = 59/69 (85%), Positives = 64/69 (92%) Frame = -2 Query: 384 FLVELAKKLPDVTFLKVDVDELKSIAADWAVEAMPTFMFLKEGKILDKVVGAKKDELQQT 205 F ELAKK+P VTFLKVDVDELKS+A DWAVEAMPTFMFLKEGKI+DKVVGAKKDELQQT Sbjct: 48 FYAELAKKMPTVTFLKVDVDELKSVATDWAVEAMPTFMFLKEGKIVDKVVGAKKDELQQT 107 Query: 204 IAKHMSTAS 178 IAKH+S+ S Sbjct: 108 IAKHISSTS 116 >ref|XP_007202766.1| hypothetical protein PRUPE_ppa013476mg [Prunus persica] gi|462398297|gb|EMJ03965.1| hypothetical protein PRUPE_ppa013476mg [Prunus persica] Length = 120 Score = 120 bits (302), Expect = 2e-25 Identities = 59/69 (85%), Positives = 65/69 (94%) Frame = -2 Query: 384 FLVELAKKLPDVTFLKVDVDELKSIAADWAVEAMPTFMFLKEGKILDKVVGAKKDELQQT 205 FL ELAKKLP+V F+KVDVDELKS+A DWAVEAMPTFMFLKEGKI+DKVVGAKKDELQQT Sbjct: 49 FLAELAKKLPNVIFVKVDVDELKSVAQDWAVEAMPTFMFLKEGKIVDKVVGAKKDELQQT 108 Query: 204 IAKHMSTAS 178 IAKH++ AS Sbjct: 109 IAKHVAAAS 117 >ref|XP_004287851.1| PREDICTED: thioredoxin H-type-like [Fragaria vesca subsp. vesca] Length = 118 Score = 119 bits (299), Expect = 3e-25 Identities = 57/69 (82%), Positives = 66/69 (95%) Frame = -2 Query: 384 FLVELAKKLPDVTFLKVDVDELKSIAADWAVEAMPTFMFLKEGKILDKVVGAKKDELQQT 205 FL ELAKKLP+V F+K+DVDELKS+A DWAVEAMPTFMFLKEGKI+DKVVGAKK+ELQQT Sbjct: 49 FLSELAKKLPNVIFVKIDVDELKSVAEDWAVEAMPTFMFLKEGKIVDKVVGAKKEELQQT 108 Query: 204 IAKHMSTAS 178 +AKH++TAS Sbjct: 109 VAKHVATAS 117 >ref|XP_004158908.1| PREDICTED: thioredoxin H-type-like [Cucumis sativus] Length = 90 Score = 116 bits (291), Expect = 3e-24 Identities = 56/69 (81%), Positives = 65/69 (94%) Frame = -2 Query: 384 FLVELAKKLPDVTFLKVDVDELKSIAADWAVEAMPTFMFLKEGKILDKVVGAKKDELQQT 205 FL ELA+K P+VTFLKVDVDEL+S+A DW VEAMPTFMFLKEG+ILDKVVGAKK+ELQQT Sbjct: 21 FLDELARKHPNVTFLKVDVDELESVAKDWGVEAMPTFMFLKEGRILDKVVGAKKEELQQT 80 Query: 204 IAKHMSTAS 178 +AKH++TAS Sbjct: 81 VAKHLATAS 89 >ref|XP_004149979.1| PREDICTED: thioredoxin H-type-like [Cucumis sativus] Length = 122 Score = 116 bits (291), Expect = 3e-24 Identities = 56/69 (81%), Positives = 65/69 (94%) Frame = -2 Query: 384 FLVELAKKLPDVTFLKVDVDELKSIAADWAVEAMPTFMFLKEGKILDKVVGAKKDELQQT 205 FL ELA+K P+VTFLKVDVDEL+S+A DW VEAMPTFMFLKEG+ILDKVVGAKK+ELQQT Sbjct: 53 FLDELARKHPNVTFLKVDVDELESVAKDWGVEAMPTFMFLKEGRILDKVVGAKKEELQQT 112 Query: 204 IAKHMSTAS 178 +AKH++TAS Sbjct: 113 VAKHLATAS 121 >ref|XP_002310830.2| thioredoxin h family protein [Populus trichocarpa] gi|118481453|gb|ABK92669.1| unknown [Populus trichocarpa] gi|550334812|gb|EEE91280.2| thioredoxin h family protein [Populus trichocarpa] Length = 122 Score = 116 bits (290), Expect = 4e-24 Identities = 56/69 (81%), Positives = 63/69 (91%) Frame = -2 Query: 384 FLVELAKKLPDVTFLKVDVDELKSIAADWAVEAMPTFMFLKEGKILDKVVGAKKDELQQT 205 FL ELA+KLPDV FLKVDVDELK++A DWAVEAMPTFMFLKEGKI+DKVVGA+KDELQQ Sbjct: 49 FLAELARKLPDVIFLKVDVDELKTVAQDWAVEAMPTFMFLKEGKIVDKVVGARKDELQQA 108 Query: 204 IAKHMSTAS 178 IAKH + A+ Sbjct: 109 IAKHTAPAA 117 >gb|EXC35509.1| Thioredoxin H-type [Morus notabilis] Length = 119 Score = 115 bits (289), Expect = 5e-24 Identities = 55/69 (79%), Positives = 65/69 (94%) Frame = -2 Query: 384 FLVELAKKLPDVTFLKVDVDELKSIAADWAVEAMPTFMFLKEGKILDKVVGAKKDELQQT 205 FLVELAK+LPDVTFLKVDVDELK +A DWAVEAMPTFMFLKEG I+DKVVGA+++ELQQT Sbjct: 49 FLVELAKRLPDVTFLKVDVDELKPVAQDWAVEAMPTFMFLKEGTIVDKVVGARREELQQT 108 Query: 204 IAKHMSTAS 178 IAKH ++++ Sbjct: 109 IAKHTASSA 117 >ref|XP_006292776.1| hypothetical protein CARUB_v10019026mg [Capsella rubella] gi|482561483|gb|EOA25674.1| hypothetical protein CARUB_v10019026mg [Capsella rubella] Length = 114 Score = 115 bits (289), Expect = 5e-24 Identities = 54/66 (81%), Positives = 62/66 (93%) Frame = -2 Query: 384 FLVELAKKLPDVTFLKVDVDELKSIAADWAVEAMPTFMFLKEGKILDKVVGAKKDELQQT 205 F +LAKKLP+V FLKVD+DELKS+A+DWA+EAMPTFMFLKEGKILDKVVGAKKDELQ T Sbjct: 49 FFADLAKKLPNVLFLKVDIDELKSVASDWAIEAMPTFMFLKEGKILDKVVGAKKDELQST 108 Query: 204 IAKHMS 187 IAKH++ Sbjct: 109 IAKHLA 114 >gb|AEC03316.1| thioredoxin H-type 2 [Hevea brasiliensis] Length = 118 Score = 115 bits (288), Expect = 6e-24 Identities = 56/69 (81%), Positives = 64/69 (92%) Frame = -2 Query: 384 FLVELAKKLPDVTFLKVDVDELKSIAADWAVEAMPTFMFLKEGKILDKVVGAKKDELQQT 205 FLVELAKKLP+V FLKVDVDELK++A DWAVEAMPTF+FL+EG ILDKVVGA KD+L +T Sbjct: 49 FLVELAKKLPNVIFLKVDVDELKTVAQDWAVEAMPTFIFLREGTILDKVVGANKDKLHET 108 Query: 204 IAKHMSTAS 178 IAKHM+TAS Sbjct: 109 IAKHMATAS 117 >ref|NP_190672.1| thioredoxin H1 [Arabidopsis thaliana] gi|297819804|ref|XP_002877785.1| hypothetical protein ARALYDRAFT_485455 [Arabidopsis lyrata subsp. lyrata] gi|267122|sp|P29448.1|TRXH1_ARATH RecName: Full=Thioredoxin H1; Short=AtTrxh1; AltName: Full=Thioredoxin 1; Short=AtTRX1 gi|16552|emb|CAA78462.1| Thioredoxin H [Arabidopsis thaliana] gi|1388080|gb|AAC49354.1| thioredoxin h [Arabidopsis thaliana] gi|6562255|emb|CAB62625.1| thioredoxin h [Arabidopsis thaliana] gi|21617958|gb|AAM67008.1| thioredoxin h [Arabidopsis thaliana] gi|297323623|gb|EFH54044.1| hypothetical protein ARALYDRAFT_485455 [Arabidopsis lyrata subsp. lyrata] gi|332645218|gb|AEE78739.1| thioredoxin H1 [Arabidopsis thaliana] Length = 114 Score = 113 bits (283), Expect = 2e-23 Identities = 53/66 (80%), Positives = 61/66 (92%) Frame = -2 Query: 384 FLVELAKKLPDVTFLKVDVDELKSIAADWAVEAMPTFMFLKEGKILDKVVGAKKDELQQT 205 F +LAKKLP+V FLKVD DELKS+A+DWA++AMPTFMFLKEGKILDKVVGAKKDELQ T Sbjct: 49 FFADLAKKLPNVLFLKVDTDELKSVASDWAIQAMPTFMFLKEGKILDKVVGAKKDELQST 108 Query: 204 IAKHMS 187 IAKH++ Sbjct: 109 IAKHLA 114