BLASTX nr result
ID: Paeonia25_contig00010867
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00010867 (445 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006601328.1| PREDICTED: peroxidase 9-like [Glycine max] 56 6e-06 >ref|XP_006601328.1| PREDICTED: peroxidase 9-like [Glycine max] Length = 343 Score = 55.8 bits (133), Expect = 6e-06 Identities = 28/49 (57%), Positives = 33/49 (67%) Frame = -2 Query: 360 LGISLRDSKIRSLNDSNNNITPPNSTLQYFFTFFKNQGPSEVYLVTLYG 214 L + RDSK SL+DSN NI PPN+T++ TFFK QG EV LV L G Sbjct: 159 LPLGRRDSKTASLSDSNKNIPPPNATIENLVTFFKRQGLDEVDLVALSG 207