BLASTX nr result
ID: Paeonia25_contig00010158
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00010158 (294 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002298040.2| glutathione S-transferase family protein [Po... 64 2e-08 gb|ADB11337.1| theta class glutathione transferase GSTT1 [Populu... 64 2e-08 ref|XP_002509785.1| glutathione-s-transferase theta, gst, putati... 59 9e-07 ref|XP_006439582.1| hypothetical protein CICLE_v10021879mg [Citr... 57 3e-06 ref|XP_004298759.1| PREDICTED: glutathione S-transferase T1-like... 57 4e-06 gb|ADB11338.1| theta class glutathione transferase GSTT2 [Populu... 55 8e-06 ref|XP_002304489.1| glutathione S-transferase family protein [Po... 55 8e-06 >ref|XP_002298040.2| glutathione S-transferase family protein [Populus trichocarpa] gi|550346875|gb|EEE82845.2| glutathione S-transferase family protein [Populus trichocarpa] Length = 247 Score = 64.3 bits (155), Expect = 2e-08 Identities = 30/38 (78%), Positives = 32/38 (84%) Frame = +3 Query: 3 WIEDTKNATGPHFDEVHQVLFKAKVLLQKRRSNGGNSE 116 W+EDTKNAT PHFDEVHQ+LFKAKV LQK RS NSE Sbjct: 200 WMEDTKNATRPHFDEVHQILFKAKVKLQKVRSMSTNSE 237 >gb|ADB11337.1| theta class glutathione transferase GSTT1 [Populus trichocarpa] Length = 247 Score = 64.3 bits (155), Expect = 2e-08 Identities = 30/38 (78%), Positives = 32/38 (84%) Frame = +3 Query: 3 WIEDTKNATGPHFDEVHQVLFKAKVLLQKRRSNGGNSE 116 W+EDTKNAT PHFDEVHQ+LFKAKV LQK RS NSE Sbjct: 200 WMEDTKNATRPHFDEVHQILFKAKVKLQKVRSMSTNSE 237 >ref|XP_002509785.1| glutathione-s-transferase theta, gst, putative [Ricinus communis] gi|223549684|gb|EEF51172.1| glutathione-s-transferase theta, gst, putative [Ricinus communis] Length = 250 Score = 58.5 bits (140), Expect = 9e-07 Identities = 26/39 (66%), Positives = 30/39 (76%) Frame = +3 Query: 3 WIEDTKNATGPHFDEVHQVLFKAKVLLQKRRSNGGNSET 119 WIED K T PHFDEVH+VLF+AK LQK++S G N ET Sbjct: 200 WIEDIKRVTRPHFDEVHKVLFRAKARLQKQQSVGANGET 238 >ref|XP_006439582.1| hypothetical protein CICLE_v10021879mg [Citrus clementina] gi|568845464|ref|XP_006476593.1| PREDICTED: glutathione S-transferase T1-like [Citrus sinensis] gi|557541844|gb|ESR52822.1| hypothetical protein CICLE_v10021879mg [Citrus clementina] Length = 247 Score = 57.0 bits (136), Expect = 3e-06 Identities = 26/37 (70%), Positives = 30/37 (81%) Frame = +3 Query: 3 WIEDTKNATGPHFDEVHQVLFKAKVLLQKRRSNGGNS 113 WIE TKNAT PHFDEVH+VLFK K LQK++S G +S Sbjct: 200 WIESTKNATRPHFDEVHEVLFKVKENLQKQQSLGASS 236 >ref|XP_004298759.1| PREDICTED: glutathione S-transferase T1-like [Fragaria vesca subsp. vesca] Length = 252 Score = 56.6 bits (135), Expect = 4e-06 Identities = 23/37 (62%), Positives = 31/37 (83%) Frame = +3 Query: 3 WIEDTKNATGPHFDEVHQVLFKAKVLLQKRRSNGGNS 113 WIE+TKNAT PHF+EVHQ+L++AK Q++RS G N+ Sbjct: 200 WIENTKNATRPHFEEVHQILYRAKTRFQEQRSMGANN 236 >gb|ADB11338.1| theta class glutathione transferase GSTT2 [Populus trichocarpa] Length = 232 Score = 55.5 bits (132), Expect = 8e-06 Identities = 25/31 (80%), Positives = 26/31 (83%) Frame = +3 Query: 3 WIEDTKNATGPHFDEVHQVLFKAKVLLQKRR 95 WIEDTKNAT PHFDEVHQ LF AKV LQ +R Sbjct: 201 WIEDTKNATKPHFDEVHQALFAAKVKLQMQR 231 >ref|XP_002304489.1| glutathione S-transferase family protein [Populus trichocarpa] gi|222841921|gb|EEE79468.1| glutathione S-transferase family protein [Populus trichocarpa] Length = 232 Score = 55.5 bits (132), Expect = 8e-06 Identities = 25/31 (80%), Positives = 26/31 (83%) Frame = +3 Query: 3 WIEDTKNATGPHFDEVHQVLFKAKVLLQKRR 95 WIEDTKNAT PHFDEVHQ LF AKV LQ +R Sbjct: 201 WIEDTKNATKPHFDEVHQALFAAKVKLQMQR 231