BLASTX nr result
ID: Paeonia25_contig00010008
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00010008 (259 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003625880.1| Spermatogenesis-associated protein [Medicago... 56 6e-06 >ref|XP_003625880.1| Spermatogenesis-associated protein [Medicago truncatula] gi|355500895|gb|AES82098.1| Spermatogenesis-associated protein [Medicago truncatula] Length = 809 Score = 55.8 bits (133), Expect = 6e-06 Identities = 33/58 (56%), Positives = 39/58 (67%), Gaps = 3/58 (5%) Frame = +3 Query: 24 AVPIFEKMLYDQGQLASVYLYAFLFAK---IGSIHVYLGIFLIRDVIAQEGQIFSAVD 188 AVP FEKMLYDQGQLA+VYL AF K S+ + +L RD+I EG+IFSA D Sbjct: 336 AVPHFEKMLYDQGQLANVYLDAFSITKDTFYSSLSRDILDYLRRDMIGPEGEIFSAED 393