BLASTX nr result
ID: Paeonia25_contig00009380
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00009380 (441 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ETW80668.1| hypothetical protein HETIRDRAFT_476366 [Heterobas... 95 9e-18 ref|XP_007307830.1| hypothetical protein STEHIDRAFT_64283 [Stere... 95 9e-18 ref|XP_007317457.1| hypothetical protein SERLADRAFT_387091 [Serp... 95 9e-18 gb|EGN99760.1| hypothetical protein SERLA73DRAFT_52918 [Serpula ... 95 9e-18 ref|XP_003030539.1| 60S ribosomal protein L39 [Schizophyllum com... 95 9e-18 ref|XP_007396899.1| hypothetical protein PHACADRAFT_98291, parti... 94 3e-17 gb|EIW63254.1| ribosomal protein L39e [Trametes versicolor FP-10... 94 3e-17 gb|EPT04564.1| hypothetical protein FOMPIDRAFT_1113577 [Fomitops... 92 7e-17 gb|EPQ56908.1| ribosomal protein L39e [Gloeophyllum trabeum ATCC... 92 7e-17 ref|XP_007362108.1| ribosomal protein L39e, partial [Dichomitus ... 92 7e-17 ref|XP_001877916.1| 60S ribosomal protein L39 [Laccaria bicolor ... 92 7e-17 gb|EIW82838.1| hypothetical protein CONPUDRAFT_163906 [Coniophor... 91 1e-16 gb|ESK90839.1| 60s ribosomal protein l39 [Moniliophthora roreri ... 90 4e-16 ref|XP_007380930.1| ribosomal protein L39e [Punctularia strigoso... 90 4e-16 ref|XP_002911749.1| 60S ribosomal protein L39 [Coprinopsis ciner... 88 1e-15 ref|XP_007266749.1| ribosomal protein L39e, partial [Fomitiporia... 87 3e-15 ref|XP_007005293.1| 60S ribosomal protein L39, partial [Tremella... 87 3e-15 ref|XP_006457253.1| hypothetical protein AGABI2DRAFT_196048 [Aga... 86 7e-15 gb|EJT97463.1| ribosomal protein L39e [Dacryopinax sp. DJM-731 SS1] 86 7e-15 ref|XP_007336288.1| hypothetical protein AURDEDRAFT_50985, parti... 84 3e-14 >gb|ETW80668.1| hypothetical protein HETIRDRAFT_476366 [Heterobasidion irregulare TC 32-1] Length = 51 Score = 95.1 bits (235), Expect = 9e-18 Identities = 44/44 (100%), Positives = 44/44 (100%) Frame = -2 Query: 386 RTKRILAKASRQNRPIPQWFRLKTDTKIQYNAKRRHWRRTKLNI 255 RTKRILAKASRQNRPIPQWFRLKTDTKIQYNAKRRHWRRTKLNI Sbjct: 8 RTKRILAKASRQNRPIPQWFRLKTDTKIQYNAKRRHWRRTKLNI 51 >ref|XP_007307830.1| hypothetical protein STEHIDRAFT_64283 [Stereum hirsutum FP-91666 SS1] gi|389741587|gb|EIM82775.1| hypothetical protein STEHIDRAFT_64283 [Stereum hirsutum FP-91666 SS1] Length = 60 Score = 95.1 bits (235), Expect = 9e-18 Identities = 44/44 (100%), Positives = 44/44 (100%) Frame = -2 Query: 386 RTKRILAKASRQNRPIPQWFRLKTDTKIQYNAKRRHWRRTKLNI 255 RTKRILAKASRQNRPIPQWFRLKTDTKIQYNAKRRHWRRTKLNI Sbjct: 17 RTKRILAKASRQNRPIPQWFRLKTDTKIQYNAKRRHWRRTKLNI 60 >ref|XP_007317457.1| hypothetical protein SERLADRAFT_387091 [Serpula lacrymans var. lacrymans S7.9] gi|336384187|gb|EGO25335.1| hypothetical protein SERLADRAFT_387091 [Serpula lacrymans var. lacrymans S7.9] Length = 51 Score = 95.1 bits (235), Expect = 9e-18 Identities = 44/44 (100%), Positives = 44/44 (100%) Frame = -2 Query: 386 RTKRILAKASRQNRPIPQWFRLKTDTKIQYNAKRRHWRRTKLNI 255 RTKRILAKASRQNRPIPQWFRLKTDTKIQYNAKRRHWRRTKLNI Sbjct: 8 RTKRILAKASRQNRPIPQWFRLKTDTKIQYNAKRRHWRRTKLNI 51 >gb|EGN99760.1| hypothetical protein SERLA73DRAFT_52918 [Serpula lacrymans var. lacrymans S7.3] Length = 50 Score = 95.1 bits (235), Expect = 9e-18 Identities = 44/44 (100%), Positives = 44/44 (100%) Frame = -2 Query: 386 RTKRILAKASRQNRPIPQWFRLKTDTKIQYNAKRRHWRRTKLNI 255 RTKRILAKASRQNRPIPQWFRLKTDTKIQYNAKRRHWRRTKLNI Sbjct: 7 RTKRILAKASRQNRPIPQWFRLKTDTKIQYNAKRRHWRRTKLNI 50 >ref|XP_003030539.1| 60S ribosomal protein L39 [Schizophyllum commune H4-8] gi|300104230|gb|EFI95636.1| hypothetical protein SCHCODRAFT_57671 [Schizophyllum commune H4-8] Length = 54 Score = 95.1 bits (235), Expect = 9e-18 Identities = 44/44 (100%), Positives = 44/44 (100%) Frame = -2 Query: 386 RTKRILAKASRQNRPIPQWFRLKTDTKIQYNAKRRHWRRTKLNI 255 RTKRILAKASRQNRPIPQWFRLKTDTKIQYNAKRRHWRRTKLNI Sbjct: 11 RTKRILAKASRQNRPIPQWFRLKTDTKIQYNAKRRHWRRTKLNI 54 >ref|XP_007396899.1| hypothetical protein PHACADRAFT_98291, partial [Phanerochaete carnosa HHB-10118-sp] gi|409044719|gb|EKM54200.1| hypothetical protein PHACADRAFT_98291, partial [Phanerochaete carnosa HHB-10118-sp] Length = 51 Score = 93.6 bits (231), Expect = 3e-17 Identities = 43/44 (97%), Positives = 44/44 (100%) Frame = -2 Query: 386 RTKRILAKASRQNRPIPQWFRLKTDTKIQYNAKRRHWRRTKLNI 255 RTKRILAKASRQNRPIPQWFRLK+DTKIQYNAKRRHWRRTKLNI Sbjct: 8 RTKRILAKASRQNRPIPQWFRLKSDTKIQYNAKRRHWRRTKLNI 51 >gb|EIW63254.1| ribosomal protein L39e [Trametes versicolor FP-101664 SS1] Length = 51 Score = 93.6 bits (231), Expect = 3e-17 Identities = 43/44 (97%), Positives = 44/44 (100%) Frame = -2 Query: 386 RTKRILAKASRQNRPIPQWFRLKTDTKIQYNAKRRHWRRTKLNI 255 RTKRILAKASRQNRPIPQWFRLK+DTKIQYNAKRRHWRRTKLNI Sbjct: 8 RTKRILAKASRQNRPIPQWFRLKSDTKIQYNAKRRHWRRTKLNI 51 >gb|EPT04564.1| hypothetical protein FOMPIDRAFT_1113577 [Fomitopsis pinicola FP-58527 SS1] Length = 71 Score = 92.0 bits (227), Expect = 7e-17 Identities = 42/44 (95%), Positives = 44/44 (100%) Frame = -2 Query: 386 RTKRILAKASRQNRPIPQWFRLKTDTKIQYNAKRRHWRRTKLNI 255 RTKRILAKASRQNRPIPQWFRLK+D+KIQYNAKRRHWRRTKLNI Sbjct: 28 RTKRILAKASRQNRPIPQWFRLKSDSKIQYNAKRRHWRRTKLNI 71 >gb|EPQ56908.1| ribosomal protein L39e [Gloeophyllum trabeum ATCC 11539] Length = 51 Score = 92.0 bits (227), Expect = 7e-17 Identities = 42/44 (95%), Positives = 43/44 (97%) Frame = -2 Query: 386 RTKRILAKASRQNRPIPQWFRLKTDTKIQYNAKRRHWRRTKLNI 255 RTKR LAKA+RQNRPIPQWFRLKTDTKIQYNAKRRHWRRTKLNI Sbjct: 8 RTKRTLAKAARQNRPIPQWFRLKTDTKIQYNAKRRHWRRTKLNI 51 >ref|XP_007362108.1| ribosomal protein L39e, partial [Dichomitus squalens LYAD-421 SS1] gi|395333094|gb|EJF65472.1| ribosomal protein L39e, partial [Dichomitus squalens LYAD-421 SS1] Length = 50 Score = 92.0 bits (227), Expect = 7e-17 Identities = 42/44 (95%), Positives = 43/44 (97%) Frame = -2 Query: 386 RTKRILAKASRQNRPIPQWFRLKTDTKIQYNAKRRHWRRTKLNI 255 RTKRILAKA RQNRPIPQWFRLK+DTKIQYNAKRRHWRRTKLNI Sbjct: 7 RTKRILAKAGRQNRPIPQWFRLKSDTKIQYNAKRRHWRRTKLNI 50 >ref|XP_001877916.1| 60S ribosomal protein L39 [Laccaria bicolor S238N-H82] gi|164647775|gb|EDR12019.1| predicted protein [Laccaria bicolor S238N-H82] Length = 51 Score = 92.0 bits (227), Expect = 7e-17 Identities = 42/44 (95%), Positives = 43/44 (97%) Frame = -2 Query: 386 RTKRILAKASRQNRPIPQWFRLKTDTKIQYNAKRRHWRRTKLNI 255 RTKRILAKA RQNRPIPQWFRLK+DTKIQYNAKRRHWRRTKLNI Sbjct: 8 RTKRILAKAGRQNRPIPQWFRLKSDTKIQYNAKRRHWRRTKLNI 51 >gb|EIW82838.1| hypothetical protein CONPUDRAFT_163906 [Coniophora puteana RWD-64-598 SS2] Length = 88 Score = 91.3 bits (225), Expect = 1e-16 Identities = 42/44 (95%), Positives = 42/44 (95%) Frame = -2 Query: 386 RTKRILAKASRQNRPIPQWFRLKTDTKIQYNAKRRHWRRTKLNI 255 RTKR LAKA RQNRPIPQWFRLKTDTKIQYNAKRRHWRRTKLNI Sbjct: 45 RTKRTLAKAHRQNRPIPQWFRLKTDTKIQYNAKRRHWRRTKLNI 88 >gb|ESK90839.1| 60s ribosomal protein l39 [Moniliophthora roreri MCA 2997] Length = 93 Score = 89.7 bits (221), Expect = 4e-16 Identities = 41/44 (93%), Positives = 43/44 (97%) Frame = -2 Query: 386 RTKRILAKASRQNRPIPQWFRLKTDTKIQYNAKRRHWRRTKLNI 255 RTK+ LAKA+RQNRPIPQWFRLKTDTKIQYNAKRRHWRRTKLNI Sbjct: 50 RTKQKLAKAARQNRPIPQWFRLKTDTKIQYNAKRRHWRRTKLNI 93 >ref|XP_007380930.1| ribosomal protein L39e [Punctularia strigosozonata HHB-11173 SS5] gi|390602010|gb|EIN11403.1| ribosomal protein L39e [Punctularia strigosozonata HHB-11173 SS5] Length = 51 Score = 89.7 bits (221), Expect = 4e-16 Identities = 41/44 (93%), Positives = 43/44 (97%) Frame = -2 Query: 386 RTKRILAKASRQNRPIPQWFRLKTDTKIQYNAKRRHWRRTKLNI 255 RTK+ LAKA+RQNRPIPQWFRLKTDTKIQYNAKRRHWRRTKLNI Sbjct: 8 RTKQKLAKAARQNRPIPQWFRLKTDTKIQYNAKRRHWRRTKLNI 51 >ref|XP_002911749.1| 60S ribosomal protein L39 [Coprinopsis cinerea okayama7#130] gi|298409812|gb|EFI28255.1| hypothetical protein CC1G_14279 [Coprinopsis cinerea okayama7#130] Length = 51 Score = 88.2 bits (217), Expect = 1e-15 Identities = 41/44 (93%), Positives = 42/44 (95%) Frame = -2 Query: 386 RTKRILAKASRQNRPIPQWFRLKTDTKIQYNAKRRHWRRTKLNI 255 RTK LAKA+RQNRPIPQWFRLKTDTKIQYNAKRRHWRRTKLNI Sbjct: 8 RTKVKLAKAARQNRPIPQWFRLKTDTKIQYNAKRRHWRRTKLNI 51 >ref|XP_007266749.1| ribosomal protein L39e, partial [Fomitiporia mediterranea MF3/22] gi|393217549|gb|EJD03038.1| ribosomal protein L39e, partial [Fomitiporia mediterranea MF3/22] Length = 50 Score = 86.7 bits (213), Expect = 3e-15 Identities = 40/44 (90%), Positives = 42/44 (95%) Frame = -2 Query: 386 RTKRILAKASRQNRPIPQWFRLKTDTKIQYNAKRRHWRRTKLNI 255 RTK LAKA+RQNRPIPQWFRLK+DTKIQYNAKRRHWRRTKLNI Sbjct: 7 RTKIKLAKAARQNRPIPQWFRLKSDTKIQYNAKRRHWRRTKLNI 50 >ref|XP_007005293.1| 60S ribosomal protein L39, partial [Tremella mesenterica DSM 1558] gi|392575590|gb|EIW68723.1| 60S ribosomal protein L39, partial [Tremella mesenterica DSM 1558] Length = 50 Score = 86.7 bits (213), Expect = 3e-15 Identities = 40/44 (90%), Positives = 41/44 (93%) Frame = -2 Query: 386 RTKRILAKASRQNRPIPQWFRLKTDTKIQYNAKRRHWRRTKLNI 255 RTK+ LAKASRQNRPIPQWFRLKTD KIQYNAKRRHWRRTKL I Sbjct: 7 RTKQKLAKASRQNRPIPQWFRLKTDNKIQYNAKRRHWRRTKLGI 50 >ref|XP_006457253.1| hypothetical protein AGABI2DRAFT_196048 [Agaricus bisporus var. bisporus H97] gi|597997615|ref|XP_007333804.1| hypothetical protein AGABI1DRAFT_116312 [Agaricus bisporus var. burnettii JB137-S8] gi|409075210|gb|EKM75593.1| hypothetical protein AGABI1DRAFT_116312 [Agaricus bisporus var. burnettii JB137-S8] gi|426192063|gb|EKV42001.1| hypothetical protein AGABI2DRAFT_196048 [Agaricus bisporus var. bisporus H97] Length = 51 Score = 85.5 bits (210), Expect = 7e-15 Identities = 38/44 (86%), Positives = 42/44 (95%) Frame = -2 Query: 386 RTKRILAKASRQNRPIPQWFRLKTDTKIQYNAKRRHWRRTKLNI 255 + K+ LAKA+RQNRPIPQWFRLKTDTKIQYNAKRRHWRRTKLN+ Sbjct: 8 KIKQKLAKAARQNRPIPQWFRLKTDTKIQYNAKRRHWRRTKLNL 51 >gb|EJT97463.1| ribosomal protein L39e [Dacryopinax sp. DJM-731 SS1] Length = 51 Score = 85.5 bits (210), Expect = 7e-15 Identities = 38/44 (86%), Positives = 42/44 (95%) Frame = -2 Query: 386 RTKRILAKASRQNRPIPQWFRLKTDTKIQYNAKRRHWRRTKLNI 255 R K+ LAKA+RQNRPIPQWFRLK+DTKIQYNAKRRHWRRTKLN+ Sbjct: 8 RVKQKLAKAARQNRPIPQWFRLKSDTKIQYNAKRRHWRRTKLNL 51 >ref|XP_007336288.1| hypothetical protein AURDEDRAFT_50985, partial [Auricularia delicata TFB-10046 SS5] gi|393248031|gb|EJD55538.1| hypothetical protein AURDEDRAFT_50985, partial [Auricularia delicata TFB-10046 SS5] Length = 56 Score = 83.6 bits (205), Expect = 3e-14 Identities = 38/44 (86%), Positives = 40/44 (90%) Frame = -2 Query: 386 RTKRILAKASRQNRPIPQWFRLKTDTKIQYNAKRRHWRRTKLNI 255 R K+ LAKASRQNRPIPQWFRLKT KIQYNAKRRHWRRTKLN+ Sbjct: 13 RVKQKLAKASRQNRPIPQWFRLKTGNKIQYNAKRRHWRRTKLNL 56